Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/HigB-HigA |
| Location | 3941861..3942588 | Replicon | chromosome |
| Accession | NZ_CP103295 | ||
| Organism | Escherichia coli strain 2e | ||
Toxin (Protein)
| Gene name | higB | Uniprot ID | J7Q991 |
| Locus tag | NW892_RS18885 | Protein ID | WP_000547564.1 |
| Coordinates | 3942277..3942588 (-) | Length | 104 a.a. |
Antitoxin (Protein)
| Gene name | higA | Uniprot ID | - |
| Locus tag | NW892_RS18880 | Protein ID | WP_000126294.1 |
| Coordinates | 3941861..3942280 (-) | Length | 140 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NW892_RS18860 (3936911) | 3936911..3937438 | - | 528 | WP_001078777.1 | electron transport protein HydN | - |
| NW892_RS18865 (3937587) | 3937587..3938597 | - | 1011 | WP_001392554.1 | DNA-binding transcriptional regulator AscG | - |
| NW892_RS18870 (3938857) | 3938857..3940314 | + | 1458 | WP_001107861.1 | PTS cellobiose/arbutin/salicin transporter subunit IIBC | - |
| NW892_RS18875 (3940323) | 3940323..3941747 | + | 1425 | WP_000110363.1 | 6-phospho-beta-glucosidase AscB | - |
| NW892_RS18880 (3941861) | 3941861..3942280 | - | 420 | WP_000126294.1 | helix-turn-helix domain-containing protein | Antitoxin |
| NW892_RS18885 (3942277) | 3942277..3942588 | - | 312 | WP_000547564.1 | type II toxin-antitoxin system HigB family toxin | Toxin |
| NW892_RS18890 (3942762) | 3942762..3943523 | - | 762 | WP_001026446.1 | hypothetical protein | - |
| NW892_RS18895 (3943548) | 3943548..3944018 | - | 471 | WP_000132961.1 | hydrogenase maturation peptidase HycI | - |
| NW892_RS18900 (3944011) | 3944011..3944421 | - | 411 | WP_001291921.1 | formate hydrogenlyase assembly protein HycH | - |
| NW892_RS18905 (3944418) | 3944418..3945185 | - | 768 | WP_000067399.1 | formate hydrogenlyase subunit HycG | - |
| NW892_RS18910 (3945185) | 3945185..3945727 | - | 543 | WP_000493792.1 | formate hydrogenlyase subunit HycF | - |
| NW892_RS18915 (3945737) | 3945737..3947446 | - | 1710 | WP_001288134.1 | formate hydrogenlyase subunit HycE | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 104 a.a. Molecular weight: 12426.13 Da Isoelectric Point: 9.7248
>T254870 WP_000547564.1 NZ_CP103295:c3942588-3942277 [Escherichia coli]
MHIISKAPFEESARKYPNDALALQALYRVIKETDFSTPEEMRTAFPNLDNFRYRNKWYVLDVGGNNLRVIAYINFVNKRF
FVKHITNHAEYDKLTRYYRENKE
MHIISKAPFEESARKYPNDALALQALYRVIKETDFSTPEEMRTAFPNLDNFRYRNKWYVLDVGGNNLRVIAYINFVNKRF
FVKHITNHAEYDKLTRYYRENKE
Download Length: 312 bp
Antitoxin
Download Length: 140 a.a. Molecular weight: 15416.42 Da Isoelectric Point: 4.4596
>AT254870 WP_000126294.1 NZ_CP103295:c3942280-3941861 [Escherichia coli]
MTANAARAVKATRELVNAVPFLGGSDSEDDYREALELVEYLIEEDDTNPLIDFLASRIAEYENNNEKFAEFDKAVAAMPV
GVALLRTLIDQHNLTYADLKNEIGSKSLVSQILSGQRSLTISHIKALSARFGVKPEWFL
MTANAARAVKATRELVNAVPFLGGSDSEDDYREALELVEYLIEEDDTNPLIDFLASRIAEYENNNEKFAEFDKAVAAMPV
GVALLRTLIDQHNLTYADLKNEIGSKSLVSQILSGQRSLTISHIKALSARFGVKPEWFL
Download Length: 420 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|