Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | yefM-yoeB (relBE)/Txe-RelB |
Location | 1604037..1604551 | Replicon | chromosome |
Accession | NZ_CP103293 | ||
Organism | Limosilactobacillus fermentum strain LfU21 |
Toxin (Protein)
Gene name | yoeB | Uniprot ID | A0A806T892 |
Locus tag | C0965_RS08255 | Protein ID | WP_021350110.1 |
Coordinates | 1604037..1604300 (-) | Length | 88 a.a. |
Antitoxin (Protein)
Gene name | yefM | Uniprot ID | C0WV67 |
Locus tag | C0965_RS08260 | Protein ID | WP_003684069.1 |
Coordinates | 1604297..1604551 (-) | Length | 85 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
C0965_RS08240 (C0965_008240) | 1599517..1600299 | + | 783 | WP_035437193.1 | arginine deiminase-related protein | - |
C0965_RS08245 (C0965_008245) | 1600687..1602084 | + | 1398 | WP_003684076.1 | Na+/H+ antiporter NhaC family protein | - |
C0965_RS08250 (C0965_008250) | 1602510..1603631 | + | 1122 | WP_021350111.1 | PTS sugar transporter subunit IIC | - |
C0965_RS08255 (C0965_008255) | 1604037..1604300 | - | 264 | WP_021350110.1 | Txe/YoeB family addiction module toxin | Toxin |
C0965_RS08260 (C0965_008260) | 1604297..1604551 | - | 255 | WP_003684069.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | Antitoxin |
C0965_RS08265 (C0965_008265) | 1604869..1606089 | + | 1221 | WP_021349406.1 | IS256 family transposase | - |
C0965_RS08270 (C0965_008270) | 1606207..1606698 | + | 492 | WP_259359296.1 | helix-turn-helix domain-containing protein | - |
C0965_RS08275 (C0965_008275) | 1606754..1607602 | + | 849 | WP_259359338.1 | IS3 family transposase | - |
C0965_RS08280 (C0965_008280) | 1607637..1608173 | + | 537 | WP_259359297.1 | DDE-type integrase/transposase/recombinase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 88 a.a. Molecular weight: 10262.99 Da Isoelectric Point: 10.7050
>T254859 WP_021350110.1 NZ_CP103293:c1604300-1604037 [Limosilactobacillus fermentum]
MSYAIKLKRSANKDLKKIKGSYLEKSFLQIIEQLRKDPLAPNQGFEKLVPPIKGFYSRRINIQHRLVYKVDQDTQTVIIY
SAWSHNR
MSYAIKLKRSANKDLKKIKGSYLEKSFLQIIEQLRKDPLAPNQGFEKLVPPIKGFYSRRINIQHRLVYKVDQDTQTVIIY
SAWSHNR
Download Length: 264 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A806T892 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A806T868 |