Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/HigB-HigA |
| Location | 89043..89770 | Replicon | plasmid p2 |
| Accession | NZ_CP102995 | ||
| Organism | Klebsiella pneumoniae strain KPA3 | ||
Toxin (Protein)
| Gene name | higB | Uniprot ID | A0A7W3D9W1 |
| Locus tag | NW255_RS27145 | Protein ID | WP_011251285.1 |
| Coordinates | 89459..89770 (-) | Length | 104 a.a. |
Antitoxin (Protein)
| Gene name | higA | Uniprot ID | - |
| Locus tag | NW255_RS27140 | Protein ID | WP_011251286.1 |
| Coordinates | 89043..89462 (-) | Length | 140 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NW255_RS27115 (NW255_27115) | 84636..86003 | + | 1368 | WP_017900870.1 | formimidoylglutamate deiminase | - |
| NW255_RS27120 (NW255_27120) | 86528..87063 | + | 536 | Protein_92 | transposase | - |
| NW255_RS27125 (NW255_27125) | 87177..87443 | - | 267 | WP_017900868.1 | hypothetical protein | - |
| NW255_RS27130 (NW255_27130) | 87547..88514 | + | 968 | Protein_94 | IS5-like element IS903B family transposase | - |
| NW255_RS27135 (NW255_27135) | 88560..88973 | - | 414 | WP_017901337.1 | hypothetical protein | - |
| NW255_RS27140 (NW255_27140) | 89043..89462 | - | 420 | WP_011251286.1 | helix-turn-helix domain-containing protein | Antitoxin |
| NW255_RS27145 (NW255_27145) | 89459..89770 | - | 312 | WP_011251285.1 | type II toxin-antitoxin system HigB family toxin | Toxin |
| NW255_RS27150 (NW255_27150) | 89975..90412 | - | 438 | Protein_98 | DDE-type integrase/transposase/recombinase | - |
| NW255_RS27155 (NW255_27155) | 90526..90903 | + | 378 | WP_004118218.1 | transposase | - |
| NW255_RS27160 (NW255_27160) | 90900..91247 | + | 348 | WP_114267527.1 | IS66 family insertion sequence element accessory protein TnpB | - |
| NW255_RS27165 (NW255_27165) | 91296..92834 | + | 1539 | WP_017901237.1 | IS66 family transposase | - |
| NW255_RS27170 (NW255_27170) | 92874..93053 | + | 180 | Protein_102 | IS5/IS1182 family transposase | - |
| NW255_RS27175 (NW255_27175) | 93599..94579 | - | 981 | WP_012569499.1 | IS5-like element ISKpn26 family transposase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Non-Mobilizable plasmid | catA1 / tet(D) | - | 1..121101 | 121101 | |
| - | inside | IScluster/Tn | - | - | 86845..96392 | 9547 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 104 a.a. Molecular weight: 12346.12 Da Isoelectric Point: 9.7248
>T254825 WP_011251285.1 NZ_CP102995:c89770-89459 [Klebsiella pneumoniae]
MHVISKEPFEEAAKRYPNDSLAIRALYRLVRETDFSSPAEMLTLIPSLDNFKYRNKWWVLDVGGNNLRVIAYINFVNKRF
YVKHIATHADYDKLTRYYRENKE
MHVISKEPFEEAAKRYPNDSLAIRALYRLVRETDFSSPAEMLTLIPSLDNFKYRNKWWVLDVGGNNLRVIAYINFVNKRF
YVKHIATHADYDKLTRYYRENKE
Download Length: 312 bp
Antitoxin
Download Length: 140 a.a. Molecular weight: 15377.46 Da Isoelectric Point: 4.4420
>AT254825 WP_011251286.1 NZ_CP102995:c89462-89043 [Klebsiella pneumoniae]
MITDTAKAIEATKQLVAAVPFLGGSSSESDYREAMELVDYLIENDDENPLIDFLASKIADYEDNSPRFAEFNKAIAEIPV
GVALLRTLIDQHKLSYSDLKDEIGSKSLVSQILSGQRSLTITHIKALSARFGVKPEWFL
MITDTAKAIEATKQLVAAVPFLGGSSSESDYREAMELVDYLIENDDENPLIDFLASKIADYEDNSPRFAEFNKAIAEIPV
GVALLRTLIDQHKLSYSDLKDEIGSKSLVSQILSGQRSLTITHIKALSARFGVKPEWFL
Download Length: 420 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|