Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/Tad-HTH_37 |
Location | 3844476..3845073 | Replicon | chromosome |
Accession | NZ_CP102993 | ||
Organism | Klebsiella pneumoniae strain KPA3 |
Toxin (Protein)
Gene name | higB | Uniprot ID | R4YIC5 |
Locus tag | NW255_RS18850 | Protein ID | WP_004142563.1 |
Coordinates | 3844756..3845073 (-) | Length | 106 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | R4YH91 |
Locus tag | NW255_RS18845 | Protein ID | WP_004142561.1 |
Coordinates | 3844476..3844763 (-) | Length | 96 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NW255_RS18815 (3840556) | 3840556..3840804 | + | 249 | WP_020325243.1 | DUF1158 domain-containing protein | - |
NW255_RS18820 (3840822) | 3840822..3841163 | - | 342 | WP_002893035.1 | RamA family antibiotic efflux transcriptional regulator | - |
NW255_RS18825 (3841194) | 3841194..3842309 | - | 1116 | WP_258825645.1 | MBL fold metallo-hydrolase | - |
NW255_RS18830 (3842489) | 3842489..3843070 | + | 582 | WP_020325240.1 | TetR/AcrR family transcriptional regulator | - |
NW255_RS18835 (3843070) | 3843070..3843438 | + | 369 | WP_020325252.1 | MmcQ/YjbR family DNA-binding protein | - |
NW255_RS18840 (3843558) | 3843558..3844211 | + | 654 | WP_004178896.1 | oxygen-insensitive NAD(P)H nitroreductase | - |
NW255_RS18845 (3844476) | 3844476..3844763 | - | 288 | WP_004142561.1 | helix-turn-helix transcriptional regulator | Antitoxin |
NW255_RS18850 (3844756) | 3844756..3845073 | - | 318 | WP_004142563.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
NW255_RS18855 (3845258) | 3845258..3846301 | - | 1044 | WP_020325241.1 | DUF2157 domain-containing protein | - |
NW255_RS18860 (3846971) | 3846971..3847837 | - | 867 | WP_004151823.1 | helix-turn-helix transcriptional regulator | - |
NW255_RS18865 (3847946) | 3847946..3849373 | + | 1428 | WP_009308097.1 | MFS transporter | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 106 a.a. Molecular weight: 12110.39 Da Isoelectric Point: 11.2767
>T254818 WP_004142563.1 NZ_CP102993:c3845073-3844756 [Klebsiella pneumoniae]
MFRLVVHVDVKKELQALPPIVQAKMIRQLDKLRQNPTALREPDSKPLGQGLFEIRALGSVQGRGIYVFQQGKTLFLLRVF
VKKTQKTPSSEIRLALKRLEEMRNE
MFRLVVHVDVKKELQALPPIVQAKMIRQLDKLRQNPTALREPDSKPLGQGLFEIRALGSVQGRGIYVFQQGKTLFLLRVF
VKKTQKTPSSEIRLALKRLEEMRNE
Download Length: 318 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0M5MXH8 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0S3DIQ1 |