Detailed information of TA system TA254809

Bioinformatically predicted

Overview

TA module

• Type: II
• Classification (family/domain): higBA (relBE)/COG4683-HTH_37
• Location: 13609..14266
• Replicon: plasmid p2
• Accession: NZ_CP102989
• Organism: Klebsiella pneumoniae strain KPA2

Toxin (Protein)

• Gene name: higB
• Uniprot ID: U3PDC3
• Locus tag: NW253_RS26930
• Protein ID: WP_000270043.1
• Coordinates: 13916..14266 (-)
• Length: 117 a.a.

Antitoxin (Protein)

• Gene name: higA
• Uniprot ID: -
• Locus tag: NW253_RS26925
• Protein ID: WP_000124640.1
• Coordinates: 13609..13911 (-)
• Length: 101 a.a.

Genomic Context

Locus tag	Coordinates	Strand	Size (bp)	Protein ID	Product	Description
NW253_RS26880 (NW253_26880)	9234..9662	+	429	WP_000591074.1	hypothetical protein	-
NW253_RS26885 (NW253_26885)	9719..10078	+	360	WP_000422768.1	hypothetical protein	-
NW253_RS26890 (NW253_26890)	10078..10524	+	447	WP_000919345.1	Fe3+-siderophore ABC transporter permease	-
NW253_RS26895 (NW253_26895)	10521..11039	+	519	WP_000210756.1	nitrite reductase	-
NW253_RS26900 (NW253_26900)	11039..11269	+	231	WP_000972663.1	hypothetical protein	-
NW253_RS26905 (NW253_26905)	11256..12113	+	858	WP_001167032.1	hypothetical protein	-
NW253_RS26910 (NW253_26910)	12344..12871	+	528	WP_001236377.1	thermonuclease family protein	-
NW253_RS26915 (NW253_26915)	12929..13201	+	273	WP_001043047.1	HU family DNA-binding protein	-
NW253_RS26920 (NW253_26920)	13289..13582	+	294	WP_001239997.1	chromosome segregation protein ParM	-
NW253_RS26925 (NW253_26925)	13609..13911	-	303	WP_000124640.1	XRE family transcriptional regulator	Antitoxin
NW253_RS26930 (NW253_26930)	13916..14266	-	351	WP_000270043.1	type II toxin-antitoxin system RelE/ParE family toxin	Toxin
NW253_RS26935 (NW253_26935)	14429..14977	+	549	WP_001061574.1	transcriptional regulator	-
NW253_RS26940 (NW253_26940)	15318..15512	+	195	WP_000343597.1	hypothetical protein	-
NW253_RS26945 (NW253_26945)	15523..15894	+	372	WP_000516916.1	hypothetical protein	-
NW253_RS26950 (NW253_26950)	15887..16357	+	471	WP_001281821.1	hypothetical protein	-
NW253_RS26955 (NW253_26955)	16372..16707	-	336	WP_000683476.1	hypothetical protein	-
NW253_RS26960 (NW253_26960)	16804..17292	+	489	WP_001273096.1	DUF1643 domain-containing protein	-
NW253_RS26965 (NW253_26965)	17295..17792	+	498	WP_000062185.1	hypothetical protein	-
NW253_RS26970 (NW253_26970)	18007..18711	-	705	WP_001067855.1	IS6-like element IS26 family transposase	-

Associated MGEs

MGE detail	Similar MGEs	Relative position	MGE Type	Cargo ARG	Virulence gene	Coordinates	Length (bp)
	-	inside	Conjugative plasmid	cmlA1 / qnrVC4 / aac(6')-Iaf / ant(2'')-Ia / floR / tet(A) / aph(6)-Id / aph(3'')-Ib / sul2 / blaCMY-2 / tet(M)	-	1..160519	160519
	-	flank	IS/Tn	cmlA1 / qnrVC4 / aac(6')-Iaf / ant(2'')-Ia / floR / tet(A) / aph(6)-Id / aph(3'')-Ib / sul2	-	18007..35311	17304

Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.

Domains

Predicted by InterproScan

Toxin

• Toxin HigB-like (12-106)

Antitoxin

• Cro/C1-type helix-turn-helix domain (33-79)

Sequences

Toxin

Protein

• Length: 117 a.a.
• Molecular weight: 13328.21 Da
• Isoelectric Point: 5.2421

>T254809 WP_000270043.1 NZ_CP102989:c14266-13916 [Klebsiella pneumoniae]
MWVIETTDTFDEWFDALDDTDRANVLASMMVLRDRGPMLSRPYADTVNGSSYSNMKELRVQSKGDPIRAFFAFDPKRKGI
LLCAGNKTGDEKRFYEVMIPIADREFAAHLDKLKKE

Nucleotide

• Length: 351 bp

Antitoxin

Protein

• Length: 101 a.a.
• Molecular weight: 11006.73 Da
• Isoelectric Point: 7.2036

>AT254809 WP_000124640.1 NZ_CP102989:c13911-13609 [Klebsiella pneumoniae]
MARTLDQMLATEKPEVVAKAQKAATEMLLNIHLAELRDRMNLTQGEIAASLGVRQPTVSEMEKPGRDLKLSSIKRYVEAS
GGKLRLDVELPDGTHYGFAV

Nucleotide

• Length: 303 bp

Structures

Toxin

• AlphaFold DB: A0A7G8AFB9