Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | phd-doc/Doc-RelB |
Location | 332124..332710 | Replicon | chromosome |
Accession | NZ_CP102987 | ||
Organism | Klebsiella pneumoniae strain KPA2 |
Toxin (Protein)
Gene name | doc | Uniprot ID | W8VD46 |
Locus tag | NW253_RS01535 | Protein ID | WP_002920800.1 |
Coordinates | 332342..332710 (+) | Length | 123 a.a. |
Antitoxin (Protein)
Gene name | phd | Uniprot ID | W9B1V1 |
Locus tag | NW253_RS01530 | Protein ID | WP_004174006.1 |
Coordinates | 332124..332345 (+) | Length | 74 a.a. |
Genomic Context
Location: 328281..329207 (927 bp)
Type: Others
Protein ID: WP_002920807.1
Type: Others
Protein ID: WP_002920807.1
Location: 329204..330481 (1278 bp)
Type: Others
Protein ID: WP_004174005.1
Type: Others
Protein ID: WP_004174005.1
Location: 330478..331245 (768 bp)
Type: Others
Protein ID: WP_002920803.1
Type: Others
Protein ID: WP_002920803.1
Location: 331247..331960 (714 bp)
Type: Others
Protein ID: WP_004145133.1
Type: Others
Protein ID: WP_004145133.1
Location: 332124..332345 (222 bp)
Type: Antitoxin
Protein ID: WP_004174006.1
Type: Antitoxin
Protein ID: WP_004174006.1
Location: 332342..332710 (369 bp)
Type: Toxin
Protein ID: WP_002920800.1
Type: Toxin
Protein ID: WP_002920800.1
Location: 332983..334299 (1317 bp)
Type: Others
Protein ID: WP_004174008.1
Type: Others
Protein ID: WP_004174008.1
Location: 334406..335293 (888 bp)
Type: Others
Protein ID: WP_002920792.1
Type: Others
Protein ID: WP_002920792.1
Location: 335290..336135 (846 bp)
Type: Others
Protein ID: WP_004145129.1
Type: Others
Protein ID: WP_004145129.1
Location: 336137..337207 (1071 bp)
Type: Others
Protein ID: WP_032433652.1
Type: Others
Protein ID: WP_032433652.1
Loading, please wait
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NW253_RS01510 (328281) | 328281..329207 | + | 927 | WP_002920807.1 | high-affinity branched-chain amino acid ABC transporter permease LivH | - |
NW253_RS01515 (329204) | 329204..330481 | + | 1278 | WP_004174005.1 | branched chain amino acid ABC transporter permease LivM | - |
NW253_RS01520 (330478) | 330478..331245 | + | 768 | WP_002920803.1 | high-affinity branched-chain amino acid ABC transporter ATP-binding protein LivG | - |
NW253_RS01525 (331247) | 331247..331960 | + | 714 | WP_004145133.1 | high-affinity branched-chain amino acid ABC transporter ATP-binding protein LivF | - |
NW253_RS01530 (332124) | 332124..332345 | + | 222 | WP_004174006.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | Antitoxin |
NW253_RS01535 (332342) | 332342..332710 | + | 369 | WP_002920800.1 | type II toxin-antitoxin system death-on-curing family toxin | Toxin |
NW253_RS01540 (332983) | 332983..334299 | + | 1317 | WP_004174008.1 | sn-glycerol-3-phosphate ABC transporter substrate-binding protein UgpB | - |
NW253_RS01545 (334406) | 334406..335293 | + | 888 | WP_002920792.1 | sn-glycerol-3-phosphate ABC transporter permease UgpA | - |
NW253_RS01550 (335290) | 335290..336135 | + | 846 | WP_004145129.1 | sn-glycerol-3-phosphate ABC transporter permease UgpE | - |
NW253_RS01555 (336137) | 336137..337207 | + | 1071 | WP_032433652.1 | sn-glycerol-3-phosphate import ATP-binding protein UgpC | - |
Associated MGEs
Loading, please wait
MGE detail | Similar MGEs | Relative position | MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
inside | Prophage | - | - | 329204..337944 | 8740 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 123 a.a. Molecular weight: 13552.92 Da Isoelectric Point: 8.6410
>T254791 WP_002920800.1 NZ_CP102987:332342-332710 [Klebsiella pneumoniae]
MTLQIISAEEIIQFHDRLLRVTPGVAGMPDPGRAEAIMYRVLNKIEYEGVTDVWRLAAMHLLAISRGHIFNDGNKRTALF
ITLLFLKRNGIILPANPDFVGMTVEAAAGQLTLEQIVARLRG
MTLQIISAEEIIQFHDRLLRVTPGVAGMPDPGRAEAIMYRVLNKIEYEGVTDVWRLAAMHLLAISRGHIFNDGNKRTALF
ITLLFLKRNGIILPANPDFVGMTVEAAAGQLTLEQIVARLRG
Download Length: 369 bp
Antitoxin
Structures
Toxin
Loading, please wait
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0H3GUD1 |
Antitoxin
Loading, please wait
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A5E5YJY7 |