Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | SprA2-SprA2AS/- |
Location | 2414642..2414826 | Replicon | chromosome |
Accession | NZ_CP102977 | ||
Organism | Staphylococcus aureus strain 27-G-H |
Toxin (Protein)
Gene name | SprA2 | Uniprot ID | A0A2P7CQJ7 |
Locus tag | NW957_RS12005 | Protein ID | WP_000482647.1 |
Coordinates | 2414719..2414826 (-) | Length | 36 a.a. |
Antitoxin (RNA)
Gene name | SprA2AS | ||
Locus tag | - | ||
Coordinates | 2414642..2414702 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NW957_RS11990 | 2410153..2410320 | - | 168 | WP_001790576.1 | hypothetical protein | - |
NW957_RS11995 | 2410550..2412283 | - | 1734 | WP_000486494.1 | ABC transporter ATP-binding protein | - |
NW957_RS12000 | 2412308..2414071 | - | 1764 | WP_001064814.1 | ABC transporter ATP-binding protein | - |
- | 2414642..2414702 | + | 61 | - | - | Antitoxin |
NW957_RS12005 | 2414719..2414826 | - | 108 | WP_000482647.1 | type I toxin-antitoxin system Fst family toxin | Toxin |
NW957_RS12010 | 2414960..2415346 | - | 387 | WP_000779360.1 | flippase GtxA | - |
NW957_RS12015 | 2415604..2416746 | + | 1143 | WP_165468810.1 | glycerate kinase | - |
NW957_RS12020 | 2416806..2417465 | + | 660 | WP_000831298.1 | membrane protein | - |
NW957_RS12025 | 2417647..2418858 | + | 1212 | WP_001192075.1 | multidrug effflux MFS transporter | - |
NW957_RS12030 | 2418981..2419454 | - | 474 | WP_000456489.1 | GyrI-like domain-containing protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 36 a.a. Molecular weight: 4012.76 Da Isoelectric Point: 10.4935
>T254789 WP_000482647.1 NZ_CP102977:c2414826-2414719 [Staphylococcus aureus]
MFNLLIDIMTSALSGCLVAFFAHWLRTRNNKKGDK
MFNLLIDIMTSALSGCLVAFFAHWLRTRNNKKGDK
Download Length: 108 bp
Antitoxin
Download Length: 61 bp
>AT254789 NZ_CP102977:2414642-2414702 [Staphylococcus aureus]
TACATAATAAATTGAACATCTAAATACACCAAATCCCCTCACTACTGCCATAGTGAGGGGA
TACATAATAAATTGAACATCTAAATACACCAAATCCCCTCACTACTGCCATAGTGAGGGGA
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|