Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | sprG-sprF/- |
Location | 2123759..2123975 | Replicon | chromosome |
Accession | NZ_CP102977 | ||
Organism | Staphylococcus aureus strain 27-G-H |
Toxin (Protein)
Gene name | SprG3 | Uniprot ID | Q2FWA7 |
Locus tag | NW957_RS10495 | Protein ID | WP_001802298.1 |
Coordinates | 2123871..2123975 (-) | Length | 35 a.a. |
Antitoxin (RNA)
Gene name | SprF1 | ||
Locus tag | - | ||
Coordinates | 2123759..2123814 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NW957_RS10470 | 2119905..2120570 | - | 666 | WP_001024095.1 | SDR family oxidoreductase | - |
NW957_RS10475 | 2120722..2121042 | + | 321 | WP_000003759.1 | Zn(II)-responsive metalloregulatory transcriptional repressor CzrA | - |
NW957_RS10480 | 2121044..2122024 | + | 981 | WP_000019744.1 | CDF family zinc efflux transporter CzrB | - |
NW957_RS10485 | 2122290..2123381 | + | 1092 | WP_000495671.1 | lytic regulatory protein | - |
- | 2123759..2123814 | + | 56 | - | - | Antitoxin |
NW957_RS10495 | 2123871..2123975 | - | 105 | WP_001802298.1 | hypothetical protein | Toxin |
NW957_RS10500 | 2124073..2124580 | - | 508 | Protein_2025 | recombinase family protein | - |
NW957_RS10505 | 2124680..2125816 | - | 1137 | WP_165468711.1 | SAP domain-containing protein | - |
NW957_RS10515 | 2126873..2127730 | - | 858 | WP_072496945.1 | HAD family hydrolase | - |
NW957_RS10520 | 2127798..2128580 | - | 783 | WP_000908182.1 | ABC transporter ATP-binding protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 35 a.a. Molecular weight: 3906.77 Da Isoelectric Point: 5.5724
>T254786 WP_001802298.1 NZ_CP102977:c2123975-2123871 [Staphylococcus aureus]
MLLLERTSMSDFEMLMVVLTIIGLVLISTQDHKK
MLLLERTSMSDFEMLMVVLTIIGLVLISTQDHKK
Download Length: 105 bp
Antitoxin
Download Length: 56 bp
>AT254786 NZ_CP102977:2123759-2123814 [Staphylococcus aureus]
AAAAAGGGCAACACTCGGAAACATGTTACCCTAATGAGCCCGTTAAAAAGACGGTG
AAAAAGGGCAACACTCGGAAACATGTTACCCTAATGAGCCCGTTAAAAAGACGGTG
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|