Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) higBA (relBE)/-
Location 1974216..1974630 Replicon chromosome
Accession NZ_CP102977
Organism Staphylococcus aureus strain 27-G-H

Toxin (Protein)


Gene name higB Uniprot ID -
Locus tag NW957_RS09685 Protein ID WP_001065046.1
Coordinates 1974379..1974630 (-) Length 84 a.a.

Antitoxin (Protein)


Gene name higA Uniprot ID -
Locus tag NW957_RS09680 Protein ID WP_000028424.1
Coordinates 1974216..1974389 (-) Length 58 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
NW957_RS09640 (1969334) 1969334..1970521 - 1188 WP_000025274.1 phage portal protein -
NW957_RS09645 (1970537) 1970537..1972198 - 1662 WP_061839008.1 terminase large subunit -
NW957_RS09650 (1972195) 1972195..1972539 - 345 WP_000402904.1 hypothetical protein -
NW957_RS09655 (1972669) 1972669..1972968 - 300 WP_000988330.1 HNH endonuclease -
NW957_RS09660 (1973200) 1973200..1973616 - 417 WP_000590122.1 hypothetical protein -
NW957_RS09665 (1973644) 1973644..1973748 - 105 Protein_1863 DUF1514 family protein -
NW957_RS09670 (1973772) 1973772..1973933 - 162 WP_178135738.1 hypothetical protein -
NW957_RS09675 (1974063) 1974063..1974215 - 153 WP_016170781.1 hypothetical protein -
NW957_RS09680 (1974216) 1974216..1974389 - 174 WP_000028424.1 hypothetical protein Antitoxin
NW957_RS09685 (1974379) 1974379..1974630 - 252 WP_001065046.1 DUF1024 family protein Toxin
NW957_RS09690 (1974645) 1974645..1974887 - 243 WP_000131381.1 phi PVL orf 51-like protein -
NW957_RS09695 (1974891) 1974891..1975259 - 369 WP_000101270.1 SA1788 family PVL leukocidin-associated protein -
NW957_RS09700 (1975272) 1975272..1975676 - 405 WP_000401964.1 RusA family crossover junction endodeoxyribonuclease -
NW957_RS09705 (1975685) 1975685..1975903 - 219 WP_000338528.1 hypothetical protein -
NW957_RS09710 (1975910) 1975910..1976794 - 885 WP_216500937.1 DnaD domain protein -
NW957_RS09715 (1976824) 1976824..1977294 - 471 WP_031807562.1 single-stranded DNA-binding protein -
NW957_RS09720 (1977295) 1977295..1977912 - 618 WP_071621397.1 MBL fold metallo-hydrolase -
NW957_RS09725 (1977993) 1977993..1978913 - 921 WP_000138473.1 recombinase RecT -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Prophage - scn / chp / sak / hlb / groEL 1948650..1999647 50997


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Protein of unknown function DUF1024

(1-82)

Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 84 a.a.        Molecular weight: 9377.26 Da        Isoelectric Point: 3.7128

>T254783 WP_001065046.1 NZ_CP102977:c1974630-1974379 [Staphylococcus aureus]
MNNREQIEQSIISASAYNGNDTEGLLKEVEDVYKKAQAFDEILEGLPNAMQDALKEDIGLDEAVGIMTGQVVYKYEEEQE
NEY

Download         Length: 252 bp

Antitoxin


Download         Length: 58 a.a.        Molecular weight: 6468.29 Da        Isoelectric Point: 4.2484

>AT254783 WP_000028424.1 NZ_CP102977:c1974389-1974216 [Staphylococcus aureus]
MSISVGDKVYNHETNESLEIVQLVGDIRDTHYKLSDDSVISIIDFITKPIYLIKGDE

Download         Length: 174 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure

References