Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | txpA-SprF1/- |
Location | 1952993..1953258 | Replicon | chromosome |
Accession | NZ_CP102977 | ||
Organism | Staphylococcus aureus strain 27-G-H |
Toxin (Protein)
Gene name | txpA | Uniprot ID | - |
Locus tag | NW957_RS09550 | Protein ID | WP_000880504.1 |
Coordinates | 1953124..1953258 (-) | Length | 45 a.a. |
Antitoxin (RNA)
Gene name | SprF1 | ||
Locus tag | - | ||
Coordinates | 1952993..1953132 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NW957_RS09510 (1948337) | 1948337..1948597 | + | 261 | WP_001791826.1 | hypothetical protein | - |
NW957_RS09515 (1948650) | 1948650..1949000 | - | 351 | WP_000702262.1 | complement inhibitor SCIN-A | - |
NW957_RS09520 (1949682) | 1949682..1950131 | + | 450 | WP_000727643.1 | chemotaxis-inhibiting protein CHIPS | - |
NW957_RS09525 (1950224) | 1950224..1950558 | - | 335 | Protein_1835 | SH3 domain-containing protein | - |
NW957_RS09530 (1951209) | 1951209..1951700 | - | 492 | WP_000920041.1 | staphylokinase | - |
NW957_RS09535 (1951891) | 1951891..1952646 | - | 756 | WP_000861038.1 | CHAP domain-containing protein | - |
NW957_RS09540 (1952658) | 1952658..1952912 | - | 255 | WP_000611512.1 | phage holin | - |
NW957_RS09545 (1952964) | 1952964..1953071 | + | 108 | WP_031762631.1 | hypothetical protein | - |
- (1952993) | 1952993..1953132 | + | 140 | NuclAT_0 | - | Antitoxin |
- (1952993) | 1952993..1953132 | + | 140 | NuclAT_0 | - | Antitoxin |
- (1952993) | 1952993..1953132 | + | 140 | NuclAT_0 | - | Antitoxin |
- (1952993) | 1952993..1953132 | + | 140 | NuclAT_0 | - | Antitoxin |
NW957_RS09550 (1953124) | 1953124..1953258 | - | 135 | WP_000880504.1 | type I toxin-antitoxin system toxin PepG1 | Toxin |
NW957_RS09555 (1953443) | 1953443..1953817 | - | 375 | WP_000340977.1 | hypothetical protein | - |
NW957_RS09560 (1953873) | 1953873..1954160 | - | 288 | WP_001262620.1 | hypothetical protein | - |
NW957_RS09565 (1954206) | 1954206..1954358 | - | 153 | WP_001000058.1 | hypothetical protein | - |
NW957_RS09570 (1954351) | 1954351..1958133 | - | 3783 | WP_000582177.1 | phage tail spike protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Prophage | - | scn / chp / sak / hlb / groEL | 1948650..1999647 | 50997 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 45 a.a. Molecular weight: 5043.38 Da Isoelectric Point: 11.7213
>T254780 WP_000880504.1 NZ_CP102977:c1953258-1953124 [Staphylococcus aureus]
MLALLKSLERRRLMITISTMLQFGLFLIALIGLVIKLIELSNKK
MLALLKSLERRRLMITISTMLQFGLFLIALIGLVIKLIELSNKK
Download Length: 135 bp
>T254780 NZ_CP102977:c1953258-1953124 [Staphylococcus aureus]
ATGTTGGCATTACTGAAATCTTTAGAAAGGAGACGCCTAATGATTACAATTAGTACCATGTTGCAGTTTGGTTTATTCCT
TATTGCATTGATAGGTCTAGTAATCAAGCTTATTGAATTAAGCAATAAAAAATAA
ATGTTGGCATTACTGAAATCTTTAGAAAGGAGACGCCTAATGATTACAATTAGTACCATGTTGCAGTTTGGTTTATTCCT
TATTGCATTGATAGGTCTAGTAATCAAGCTTATTGAATTAAGCAATAAAAAATAA
Antitoxin
Download Length: 140 bp
>AT254780 NZ_CP102977:1952993-1953132 [Staphylococcus aureus]
ATATATAGAAAAAGGGCAACATGCGCAAACATGTTACCCTAGTGAGCCCGTTAAAAAGACGGTGGCTATTTTAGATTAAA
GATTAAATTAATAACCATTTAACCATCGAAACCAGCCAAAGTTAGCGATGGTTATTTTTT
ATATATAGAAAAAGGGCAACATGCGCAAACATGTTACCCTAGTGAGCCCGTTAAAAAGACGGTGGCTATTTTAGATTAAA
GATTAAATTAATAACCATTTAACCATCGAAACCAGCCAAAGTTAGCGATGGTTATTTTTT
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|