Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | SprA2-SprA2AS/- |
| Location | 2443162..2443346 | Replicon | chromosome |
| Accession | NZ_CP102975 | ||
| Organism | Staphylococcus aureus strain 16CS0209 | ||
Toxin (Protein)
| Gene name | SprA2 | Uniprot ID | - |
| Locus tag | NW953_RS12040 | Protein ID | WP_047527328.1 |
| Coordinates | 2443239..2443346 (-) | Length | 36 a.a. |
Antitoxin (RNA)
| Gene name | SprA2AS | ||
| Locus tag | - | ||
| Coordinates | 2443162..2443222 (+) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NW953_RS12015 (NW953_12015) | 2438706..2439821 | - | 1116 | WP_258410005.1 | pyridoxal phosphate-dependent aminotransferase family protein | - |
| NW953_RS12020 (NW953_12020) | 2439799..2440806 | - | 1008 | WP_258409385.1 | biotin synthase BioB | - |
| NW953_RS12025 (NW953_12025) | 2440808..2442166 | - | 1359 | WP_234746880.1 | adenosylmethionine--8-amino-7-oxononanoate transaminase | - |
| NW953_RS12030 (NW953_12030) | 2442144..2442830 | - | 687 | WP_258409386.1 | dethiobiotin synthase | - |
| NW953_RS12035 (NW953_12035) | 2442885..2443052 | - | 168 | WP_258409387.1 | hypothetical protein | - |
| - | 2443162..2443222 | + | 61 | - | - | Antitoxin |
| NW953_RS12040 (NW953_12040) | 2443239..2443346 | - | 108 | WP_047527328.1 | type I toxin-antitoxin system Fst family toxin | Toxin |
| NW953_RS12045 (NW953_12045) | 2443480..2443866 | - | 387 | WP_000779353.1 | flippase GtxA | - |
| NW953_RS12050 (NW953_12050) | 2444134..2445276 | + | 1143 | WP_258409388.1 | glycerate kinase | - |
| NW953_RS12055 (NW953_12055) | 2445336..2445995 | + | 660 | WP_258409389.1 | hypothetical protein | - |
| NW953_RS12060 (NW953_12060) | 2446175..2447386 | + | 1212 | WP_258409390.1 | multidrug effflux MFS transporter | - |
| NW953_RS12065 (NW953_12065) | 2447509..2447982 | - | 474 | WP_258409391.1 | GyrI-like domain-containing protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 36 a.a. Molecular weight: 4012.76 Da Isoelectric Point: 10.4935
>T254776 WP_047527328.1 NZ_CP102975:c2443346-2443239 [Staphylococcus aureus]
MFNLLIDIMTSAISGCLVAFFAHWLRTRNNKKGDK
MFNLLIDIMTSAISGCLVAFFAHWLRTRNNKKGDK
Download Length: 108 bp
Antitoxin
Download Length: 61 bp
>AT254776 NZ_CP102975:2443162-2443222 [Staphylococcus aureus]
TACATAATAAATTGAACATCTAAATACACCAAATCCCCTCACTACTGCCATAGTGAGGGGA
TACATAATAAATTGAACATCTAAATACACCAAATCCCCTCACTACTGCCATAGTGAGGGGA
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|