Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | sprA1-sprA1AS/- |
| Location | 1862593..1862773 | Replicon | chromosome |
| Accession | NZ_CP102975 | ||
| Organism | Staphylococcus aureus strain 16CS0209 | ||
Toxin (Protein)
| Gene name | sprA1 | Uniprot ID | - |
| Locus tag | NW953_RS08905 | Protein ID | WP_001801861.1 |
| Coordinates | 1862593..1862688 (+) | Length | 32 a.a. |
Antitoxin (RNA)
| Gene name | sprA1AS | ||
| Locus tag | - | ||
| Coordinates | 1862716..1862773 (-) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NW953_RS08865 (NW953_08865) | 1858011..1859006 | + | 996 | WP_000070644.1 | DUF4352 domain-containing protein | - |
| NW953_RS08870 (NW953_08870) | 1859082..1859708 | + | 627 | WP_000669036.1 | hypothetical protein | - |
| NW953_RS08875 (NW953_08875) | 1859799..1860143 | + | 345 | WP_258409228.1 | DUF3969 family protein | - |
| NW953_RS08880 (NW953_08880) | 1860241..1860813 | + | 573 | WP_072512307.1 | hypothetical protein | - |
| NW953_RS08885 (NW953_08885) | 1861145..1861330 | - | 186 | WP_000809743.1 | hypothetical protein | - |
| NW953_RS08890 (NW953_08890) | 1861332..1861507 | - | 176 | Protein_1747 | hypothetical protein | - |
| NW953_RS08895 (NW953_08895) | 1861518..1861901 | - | 384 | WP_258409229.1 | hypothetical protein | - |
| NW953_RS08905 (NW953_08905) | 1862593..1862688 | + | 96 | WP_001801861.1 | type I toxin-antitoxin system Fst family toxin PepA1 | Toxin |
| - | 1862716..1862773 | - | 58 | - | - | Antitoxin |
| NW953_RS08910 (NW953_08910) | 1862811..1862912 | + | 102 | WP_258409231.1 | hypothetical protein | - |
| NW953_RS08915 (NW953_08915) | 1862890..1863150 | - | 261 | Protein_1751 | transposase | - |
| NW953_RS08920 (NW953_08920) | 1863347..1864567 | - | 1221 | WP_258409232.1 | restriction endonuclease subunit S | - |
| NW953_RS08925 (NW953_08925) | 1864560..1866116 | - | 1557 | WP_258409233.1 | type I restriction-modification system subunit M | - |
| NW953_RS08930 (NW953_08930) | 1866280..1866414 | - | 135 | Protein_1754 | hypothetical protein | - |
| NW953_RS08935 (NW953_08935) | 1866479..1867198 | - | 720 | WP_001038742.1 | serine protease SplF | - |
| NW953_RS08940 (NW953_08940) | 1867302..1867419 | + | 118 | Protein_1756 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Prophage | - | lukD / hlgA | 1856510..1919972 | 63462 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 32 a.a. Molecular weight: 3554.32 Da Isoelectric Point: 10.4449
>T254768 WP_001801861.1 NZ_CP102975:1862593-1862688 [Staphylococcus aureus]
VMLIFVHIIAPVISGCAIAFFSYWLSRRNTK
VMLIFVHIIAPVISGCAIAFFSYWLSRRNTK
Download Length: 96 bp
Antitoxin
Download Length: 58 bp
>AT254768 NZ_CP102975:c1862773-1862716 [Staphylococcus aureus]
AACGAAAATAAGTATTTACTTATACACCAATCCCCTCACTATTTGCGGTAGTGAGGGG
AACGAAAATAAGTATTTACTTATACACCAATCCCCTCACTATTTGCGGTAGTGAGGGG
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
