Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | SprA2-SprA2AS/- |
Location | 2428919..2429103 | Replicon | chromosome |
Accession | NZ_CP102974 | ||
Organism | Staphylococcus aureus strain 01-RR-86 |
Toxin (Protein)
Gene name | SprA2 | Uniprot ID | A0A2P7CQJ7 |
Locus tag | NW945_RS11970 | Protein ID | WP_000482647.1 |
Coordinates | 2428996..2429103 (-) | Length | 36 a.a. |
Antitoxin (RNA)
Gene name | SprA2AS | ||
Locus tag | - | ||
Coordinates | 2428919..2428979 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NW945_RS11955 (NW945_11955) | 2424373..2424540 | - | 168 | WP_001790576.1 | hypothetical protein | - |
NW945_RS11960 (NW945_11960) | 2424771..2426504 | - | 1734 | WP_000486494.1 | ABC transporter ATP-binding protein | - |
NW945_RS11965 (NW945_11965) | 2426529..2428292 | - | 1764 | WP_001064835.1 | ATP-binding cassette domain-containing protein | - |
- | 2428919..2428979 | + | 61 | - | - | Antitoxin |
NW945_RS11970 (NW945_11970) | 2428996..2429103 | - | 108 | WP_000482647.1 | type I toxin-antitoxin system Fst family toxin | Toxin |
NW945_RS11975 (NW945_11975) | 2429237..2429623 | - | 387 | WP_000779360.1 | flippase GtxA | - |
NW945_RS11980 (NW945_11980) | 2429881..2431023 | + | 1143 | WP_001176863.1 | glycerate kinase | - |
NW945_RS11985 (NW945_11985) | 2431083..2431742 | + | 660 | WP_000831298.1 | membrane protein | - |
NW945_RS11990 (NW945_11990) | 2431924..2433135 | + | 1212 | WP_001192075.1 | multidrug effflux MFS transporter | - |
NW945_RS11995 (NW945_11995) | 2433258..2433731 | - | 474 | WP_000456489.1 | GyrI-like domain-containing protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 36 a.a. Molecular weight: 4012.76 Da Isoelectric Point: 10.4935
>T254765 WP_000482647.1 NZ_CP102974:c2429103-2428996 [Staphylococcus aureus]
MFNLLIDIMTSALSGCLVAFFAHWLRTRNNKKGDK
MFNLLIDIMTSALSGCLVAFFAHWLRTRNNKKGDK
Download Length: 108 bp
Antitoxin
Download Length: 61 bp
>AT254765 NZ_CP102974:2428919-2428979 [Staphylococcus aureus]
TACATAATAAATTGAACATCTAAATACACCAAATCCCCTCACTACTGCCATAGTGAGGGGA
TACATAATAAATTGAACATCTAAATACACCAAATCCCCTCACTACTGCCATAGTGAGGGGA
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|