Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | SprG3-SprA2AS/- |
Location | 2123668..2123865 | Replicon | chromosome |
Accession | NZ_CP102974 | ||
Organism | Staphylococcus aureus strain 01-RR-86 |
Toxin (Protein)
Gene name | SprG3 | Uniprot ID | - |
Locus tag | NW945_RS10375 | Protein ID | WP_258414267.1 |
Coordinates | 2123761..2123865 (-) | Length | 35 a.a. |
Antitoxin (RNA)
Gene name | SprA2AS | ||
Locus tag | - | ||
Coordinates | 2123668..2123706 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NW945_RS10355 (NW945_10355) | 2119786..2120451 | - | 666 | WP_001024095.1 | SDR family oxidoreductase | - |
NW945_RS10360 (NW945_10360) | 2120603..2120923 | + | 321 | WP_000003759.1 | Zn(II)-responsive metalloregulatory transcriptional repressor CzrA | - |
NW945_RS10365 (NW945_10365) | 2120925..2121905 | + | 981 | WP_000019743.1 | CDF family zinc efflux transporter CzrB | - |
NW945_RS10370 (NW945_10370) | 2122171..2123262 | + | 1092 | WP_000495682.1 | hypothetical protein | - |
- | 2123668..2123706 | + | 39 | - | - | Antitoxin |
NW945_RS10375 (NW945_10375) | 2123761..2123865 | - | 105 | WP_258414267.1 | hypothetical protein | Toxin |
NW945_RS10380 (NW945_10380) | 2124382..2124552 | + | 171 | WP_001792292.1 | transposase | - |
NW945_RS10385 (NW945_10385) | 2124545..2124703 | + | 159 | WP_001792784.1 | hypothetical protein | - |
NW945_RS10390 (NW945_10390) | 2125362..2126219 | - | 858 | WP_000370931.1 | HAD family hydrolase | - |
NW945_RS10395 (NW945_10395) | 2126287..2127069 | - | 783 | WP_258414268.1 | ABC transporter ATP-binding protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 35 a.a. Molecular weight: 3897.76 Da Isoelectric Point: 4.5441
>T254763 WP_258414267.1 NZ_CP102974:c2123865-2123761 [Staphylococcus aureus]
MLLLERTSMSDFEMLMVVLTIIGLVLISTQDQKK
MLLLERTSMSDFEMLMVVLTIIGLVLISTQDQKK
Download Length: 105 bp
Antitoxin
Download Length: 39 bp
>AT254763 NZ_CP102974:2123668-2123706 [Staphylococcus aureus]
AACATGTTACCCTAATGAGCCCGTTAAAAAGACGGTGAC
AACATGTTACCCTAATGAGCCCGTTAAAAAGACGGTGAC
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|