Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | sprA1-sprA1AS/- |
| Location | 1836628..1836808 | Replicon | chromosome |
| Accession | NZ_CP102974 | ||
| Organism | Staphylococcus aureus strain 01-RR-86 | ||
Toxin (Protein)
| Gene name | sprA1 | Uniprot ID | - |
| Locus tag | NW945_RS08755 | Protein ID | WP_001801861.1 |
| Coordinates | 1836628..1836723 (+) | Length | 32 a.a. |
Antitoxin (RNA)
| Gene name | sprA1AS | ||
| Locus tag | - | ||
| Coordinates | 1836751..1836808 (-) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NW945_RS08715 (NW945_08715) | 1831665..1832291 | + | 627 | WP_258414226.1 | hypothetical protein | - |
| NW945_RS08720 (NW945_08720) | 1832332..1832673 | + | 342 | WP_103204924.1 | DUF3969 family protein | - |
| NW945_RS08725 (NW945_08725) | 1832774..1833346 | + | 573 | WP_258414227.1 | hypothetical protein | - |
| NW945_RS08730 (NW945_08730) | 1833544..1834172 | - | 629 | Protein_1716 | ImmA/IrrE family metallo-endopeptidase | - |
| NW945_RS08735 (NW945_08735) | 1834286..1834471 | - | 186 | WP_072468070.1 | hypothetical protein | - |
| NW945_RS08740 (NW945_08740) | 1834473..1834649 | - | 177 | WP_103188592.1 | hypothetical protein | - |
| NW945_RS08745 (NW945_08745) | 1834660..1835043 | - | 384 | WP_000070811.1 | hypothetical protein | - |
| NW945_RS08750 (NW945_08750) | 1835730..1836176 | - | 447 | WP_258410738.1 | DUF1433 domain-containing protein | - |
| NW945_RS08755 (NW945_08755) | 1836628..1836723 | + | 96 | WP_001801861.1 | type I toxin-antitoxin system Fst family toxin PepA1 | Toxin |
| - | 1836751..1836808 | - | 58 | - | - | Antitoxin |
| NW945_RS08760 (NW945_08760) | 1836846..1836944 | + | 99 | Protein_1722 | hypothetical protein | - |
| NW945_RS08765 (NW945_08765) | 1836964..1837095 | + | 132 | WP_258414228.1 | hypothetical protein | - |
| NW945_RS08770 (NW945_08770) | 1837676..1838119 | - | 444 | WP_258410740.1 | DUF1433 domain-containing protein | - |
| NW945_RS08775 (NW945_08775) | 1838119..1838562 | - | 444 | WP_258410741.1 | DUF1433 domain-containing protein | - |
| NW945_RS08780 (NW945_08780) | 1838562..1839005 | - | 444 | WP_258410742.1 | DUF1433 domain-containing protein | - |
| NW945_RS08785 (NW945_08785) | 1839641..1840861 | - | 1221 | WP_258410743.1 | restriction endonuclease subunit S | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 32 a.a. Molecular weight: 3554.32 Da Isoelectric Point: 10.4449
>T254758 WP_001801861.1 NZ_CP102974:1836628-1836723 [Staphylococcus aureus]
VMLIFVHIIAPVISGCAIAFFSYWLSRRNTK
VMLIFVHIIAPVISGCAIAFFSYWLSRRNTK
Download Length: 96 bp
Antitoxin
Download Length: 58 bp
>AT254758 NZ_CP102974:c1836808-1836751 [Staphylococcus aureus]
AACGAAAATAAGTATTTACTTATACACCAATCCCCTCACTATTTGCGGTAGTGAGGGG
AACGAAAATAAGTATTTACTTATACACCAATCCCCTCACTATTTGCGGTAGTGAGGGG
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|