Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | SprA2-SprA2AS/- |
Location | 2506368..2506552 | Replicon | chromosome |
Accession | NZ_CP102972 | ||
Organism | Staphylococcus aureus strain 05-RR-90 |
Toxin (Protein)
Gene name | SprA2 | Uniprot ID | A0A2P7CQJ7 |
Locus tag | NW963_RS12565 | Protein ID | WP_000482647.1 |
Coordinates | 2506445..2506552 (-) | Length | 36 a.a. |
Antitoxin (RNA)
Gene name | SprA2AS | ||
Locus tag | - | ||
Coordinates | 2506368..2506428 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NW963_RS12555 (NW963_12550) | 2502296..2504029 | - | 1734 | WP_258410232.1 | ABC transporter ATP-binding protein | - |
NW963_RS12560 (NW963_12555) | 2504054..2505817 | - | 1764 | WP_001064814.1 | ABC transporter ATP-binding protein | - |
- | 2506368..2506428 | + | 61 | - | - | Antitoxin |
NW963_RS12565 (NW963_12560) | 2506445..2506552 | - | 108 | WP_000482647.1 | type I toxin-antitoxin system Fst family toxin | Toxin |
NW963_RS12570 (NW963_12565) | 2506686..2507072 | - | 387 | WP_000779347.1 | flippase GtxA | - |
NW963_RS12575 (NW963_12570) | 2507330..2508472 | + | 1143 | WP_001176863.1 | glycerate kinase | - |
NW963_RS12580 (NW963_12575) | 2508532..2509191 | + | 660 | WP_000831298.1 | membrane protein | - |
NW963_RS12585 (NW963_12580) | 2509373..2510584 | + | 1212 | WP_001192075.1 | multidrug effflux MFS transporter | - |
NW963_RS12590 (NW963_12585) | 2510707..2511180 | - | 474 | WP_000456489.1 | GyrI-like domain-containing protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | flank | IS/Tn | - | - | 2500302..2501948 | 1646 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 36 a.a. Molecular weight: 4012.76 Da Isoelectric Point: 10.4935
>T254755 WP_000482647.1 NZ_CP102972:c2506552-2506445 [Staphylococcus aureus]
MFNLLIDIMTSALSGCLVAFFAHWLRTRNNKKGDK
MFNLLIDIMTSALSGCLVAFFAHWLRTRNNKKGDK
Download Length: 108 bp
Antitoxin
Download Length: 61 bp
>AT254755 NZ_CP102972:2506368-2506428 [Staphylococcus aureus]
TACATAATAAATTGAACATCTAAATACACCAAATCCCCTCACTACTGCCATAGTGAGGGGA
TACATAATAAATTGAACATCTAAATACACCAAATCCCCTCACTACTGCCATAGTGAGGGGA
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|