Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | sprG-sprF/- |
Location | 2173627..2173889 | Replicon | chromosome |
Accession | NZ_CP102972 | ||
Organism | Staphylococcus aureus strain 05-RR-90 |
Toxin (Protein)
Gene name | SprG3 | Uniprot ID | Q2FWA7 |
Locus tag | NW963_RS10755 | Protein ID | WP_001802298.1 |
Coordinates | 2173785..2173889 (-) | Length | 35 a.a. |
Antitoxin (RNA)
Gene name | SprF2 | ||
Locus tag | - | ||
Coordinates | 2173627..2173790 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NW963_RS10730 (NW963_10725) | 2169867..2170532 | - | 666 | WP_001024095.1 | SDR family oxidoreductase | - |
NW963_RS10735 (NW963_10730) | 2170684..2171004 | + | 321 | WP_000003759.1 | Zn(II)-responsive metalloregulatory transcriptional repressor CzrA | - |
NW963_RS10740 (NW963_10735) | 2171006..2171986 | + | 981 | WP_258412249.1 | CDF family zinc efflux transporter CzrB | - |
NW963_RS10745 (NW963_10740) | 2172252..2173343 | + | 1092 | WP_258412250.1 | transcriptional regulator | - |
- | 2173627..2173790 | + | 164 | - | - | Antitoxin |
NW963_RS10755 (NW963_10750) | 2173785..2173889 | - | 105 | WP_001802298.1 | hypothetical protein | Toxin |
NW963_RS10760 (NW963_10755) | 2174406..2174576 | + | 171 | WP_001792292.1 | transposase | - |
NW963_RS10765 (NW963_10760) | 2174569..2174727 | + | 159 | WP_001792784.1 | hypothetical protein | - |
NW963_RS10770 (NW963_10765) | 2175385..2176242 | - | 858 | WP_258412251.1 | HAD family hydrolase | - |
NW963_RS10775 (NW963_10770) | 2176310..2177092 | - | 783 | WP_258412252.1 | ABC transporter ATP-binding protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 35 a.a. Molecular weight: 3906.77 Da Isoelectric Point: 5.5724
>T254753 WP_001802298.1 NZ_CP102972:c2173889-2173785 [Staphylococcus aureus]
MLLLERTSMSDFEMLMVVLTIIGLVLISTQDHKK
MLLLERTSMSDFEMLMVVLTIIGLVLISTQDHKK
Download Length: 105 bp
Antitoxin
Download Length: 164 bp
>AT254753 NZ_CP102972:2173627-2173790 [Staphylococcus aureus]
GTAGTAAGTAGAAGCAAAAGATGAAAATCTTTAACTCTTGAAACACAAAAAGGGCAACACTCGGAAACATGTTACCCTAA
TGAACCCGTTAAAAAGACGGTGACCTTATATTTTATTTAAAAATAGCCTTCAAAATGCCGGTCAAAGCGAATAGAAGGTT
ATTT
GTAGTAAGTAGAAGCAAAAGATGAAAATCTTTAACTCTTGAAACACAAAAAGGGCAACACTCGGAAACATGTTACCCTAA
TGAACCCGTTAAAAAGACGGTGACCTTATATTTTATTTAAAAATAGCCTTCAAAATGCCGGTCAAAGCGAATAGAAGGTT
ATTT
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|