Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | SprA2-SprA2AS/- |
Location | 2426128..2426312 | Replicon | chromosome |
Accession | NZ_CP102971 | ||
Organism | Staphylococcus aureus strain 08-G-E |
Toxin (Protein)
Gene name | SprA2 | Uniprot ID | Q2FVI9 |
Locus tag | NW975_RS11955 | Protein ID | WP_000482650.1 |
Coordinates | 2426205..2426312 (-) | Length | 36 a.a. |
Antitoxin (RNA)
Gene name | SprA2AS | ||
Locus tag | - | ||
Coordinates | 2426128..2426188 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NW975_RS11940 (NW975_11940) | 2421582..2421749 | - | 168 | WP_258414742.1 | hypothetical protein | - |
NW975_RS11945 (NW975_11945) | 2421980..2423713 | - | 1734 | WP_049307645.1 | ABC transporter ATP-binding protein | - |
NW975_RS11950 (NW975_11950) | 2423738..2425501 | - | 1764 | WP_001064837.1 | ABC transporter ATP-binding protein | - |
- | 2426128..2426188 | + | 61 | - | - | Antitoxin |
NW975_RS11955 (NW975_11955) | 2426205..2426312 | - | 108 | WP_000482650.1 | type I toxin-antitoxin system Fst family toxin | Toxin |
NW975_RS11960 (NW975_11960) | 2426446..2426832 | - | 387 | WP_000779358.1 | flippase GtxA | - |
NW975_RS11965 (NW975_11965) | 2427100..2428242 | + | 1143 | WP_001176863.1 | glycerate kinase | - |
NW975_RS11970 (NW975_11970) | 2428302..2428961 | + | 660 | WP_000831298.1 | membrane protein | - |
NW975_RS11975 (NW975_11975) | 2429143..2430354 | + | 1212 | WP_001192075.1 | multidrug effflux MFS transporter | - |
NW975_RS11980 (NW975_11980) | 2430477..2430950 | - | 474 | WP_000456489.1 | GyrI-like domain-containing protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 36 a.a. Molecular weight: 4011.78 Da Isoelectric Point: 11.0582
>T254745 WP_000482650.1 NZ_CP102971:c2426312-2426205 [Staphylococcus aureus]
MFNLLINIMTSAISGCLVAFFAHWLRTRNNKKGDK
MFNLLINIMTSAISGCLVAFFAHWLRTRNNKKGDK
Download Length: 108 bp
Antitoxin
Download Length: 61 bp
>AT254745 NZ_CP102971:2426128-2426188 [Staphylococcus aureus]
TACATAATAAATTGAACATCTAAATACACCAAATCCCCTCACTACTGCCATAGTGAGGGGA
TACATAATAAATTGAACATCTAAATACACCAAATCCCCTCACTACTGCCATAGTGAGGGGA
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|