Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | SprG3-sprA1AS/- |
Location | 2132855..2133052 | Replicon | chromosome |
Accession | NZ_CP102971 | ||
Organism | Staphylococcus aureus strain 08-G-E |
Toxin (Protein)
Gene name | SprG3 | Uniprot ID | Q2FWA7 |
Locus tag | NW975_RS10445 | Protein ID | WP_001802298.1 |
Coordinates | 2132948..2133052 (-) | Length | 35 a.a. |
Antitoxin (RNA)
Gene name | sprA1AS | ||
Locus tag | - | ||
Coordinates | 2132855..2132893 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NW975_RS10420 (NW975_10420) | 2128973..2129638 | - | 666 | WP_001024095.1 | SDR family oxidoreductase | - |
NW975_RS10425 (NW975_10425) | 2129790..2130110 | + | 321 | WP_000003759.1 | Zn(II)-responsive metalloregulatory transcriptional repressor CzrA | - |
NW975_RS10430 (NW975_10430) | 2130112..2131092 | + | 981 | WP_000019744.1 | CDF family zinc efflux transporter CzrB | - |
NW975_RS10435 (NW975_10435) | 2131358..2132449 | + | 1092 | WP_258412250.1 | transcriptional regulator | - |
NW975_RS10440 (NW975_10440) | 2132835..2132909 | + | 75 | Protein_2013 | hypothetical protein | - |
- | 2132855..2132893 | + | 39 | - | - | Antitoxin |
NW975_RS10445 (NW975_10445) | 2132948..2133052 | - | 105 | WP_001802298.1 | hypothetical protein | Toxin |
NW975_RS10450 (NW975_10450) | 2133732..2133890 | + | 159 | WP_001792784.1 | hypothetical protein | - |
NW975_RS10455 (NW975_10455) | 2134548..2135405 | - | 858 | WP_000370925.1 | Cof-type HAD-IIB family hydrolase | - |
NW975_RS10460 (NW975_10460) | 2135473..2136255 | - | 783 | WP_258412620.1 | ABC transporter ATP-binding protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 35 a.a. Molecular weight: 3906.77 Da Isoelectric Point: 5.5724
>T254743 WP_001802298.1 NZ_CP102971:c2133052-2132948 [Staphylococcus aureus]
MLLLERTSMSDFEMLMVVLTIIGLVLISTQDHKK
MLLLERTSMSDFEMLMVVLTIIGLVLISTQDHKK
Download Length: 105 bp
Antitoxin
Download Length: 39 bp
>AT254743 NZ_CP102971:2132855-2132893 [Staphylococcus aureus]
AACATGTTACCCTAATGAGCCCGTTAAAAAGACGGTGAC
AACATGTTACCCTAATGAGCCCGTTAAAAAGACGGTGAC
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|