Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | sprA1-sprA1AS/- |
| Location | 1839437..1839617 | Replicon | chromosome |
| Accession | NZ_CP102971 | ||
| Organism | Staphylococcus aureus strain 08-G-E | ||
Toxin (Protein)
| Gene name | sprA1 | Uniprot ID | - |
| Locus tag | NW975_RS08780 | Protein ID | WP_001801861.1 |
| Coordinates | 1839437..1839532 (+) | Length | 32 a.a. |
Antitoxin (RNA)
| Gene name | sprA1AS | ||
| Locus tag | - | ||
| Coordinates | 1839560..1839617 (-) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NW975_RS08745 (NW975_08745) | 1835205..1835831 | + | 627 | WP_045177256.1 | hypothetical protein | - |
| NW975_RS08750 (NW975_08750) | 1835872..1836213 | + | 342 | WP_045177258.1 | DUF3969 family protein | - |
| NW975_RS08755 (NW975_08755) | 1836314..1836886 | + | 573 | WP_045177260.1 | hypothetical protein | - |
| NW975_RS08760 (NW975_08760) | 1837084..1837712 | - | 629 | Protein_1721 | ImmA/IrrE family metallo-endopeptidase | - |
| NW975_RS08765 (NW975_08765) | 1838015..1838191 | - | 177 | WP_000375477.1 | hypothetical protein | - |
| NW975_RS08770 (NW975_08770) | 1838202..1838585 | - | 384 | WP_000070811.1 | hypothetical protein | - |
| NW975_RS08775 (NW975_08775) | 1839028..1839309 | - | 282 | WP_258414718.1 | transposase | - |
| NW975_RS08780 (NW975_08780) | 1839437..1839532 | + | 96 | WP_001801861.1 | type I toxin-antitoxin system Fst family toxin PepA1 | Toxin |
| - | 1839560..1839617 | - | 58 | - | - | Antitoxin |
| NW975_RS08785 (NW975_08785) | 1839655..1839756 | + | 102 | WP_001791232.1 | hypothetical protein | - |
| NW975_RS08790 (NW975_08790) | 1839931..1840374 | - | 444 | WP_086153312.1 | DUF1433 domain-containing protein | - |
| NW975_RS08795 (NW975_08795) | 1840374..1840817 | - | 444 | WP_000439996.1 | DUF1433 domain-containing protein | - |
| NW975_RS08800 (NW975_08800) | 1840860..1842470 | + | 1611 | WP_258411728.1 | lipase | - |
| NW975_RS08805 (NW975_08805) | 1842485..1842784 | + | 300 | WP_000095392.1 | WXG100 family type VII secretion target | - |
| NW975_RS08810 (NW975_08810) | 1843021..1844280 | - | 1260 | WP_258411729.1 | restriction endonuclease subunit S | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Prophage | - | lukD / hlgA / selk | 1832645..1903326 | 70681 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 32 a.a. Molecular weight: 3554.32 Da Isoelectric Point: 10.4449
>T254739 WP_001801861.1 NZ_CP102971:1839437-1839532 [Staphylococcus aureus]
VMLIFVHIIAPVISGCAIAFFSYWLSRRNTK
VMLIFVHIIAPVISGCAIAFFSYWLSRRNTK
Download Length: 96 bp
Antitoxin
Download Length: 58 bp
>AT254739 NZ_CP102971:c1839617-1839560 [Staphylococcus aureus]
AACGAAAATAAGTATTTACTTATACACCAATCCCCTCACTATTTGCGGTAGTGAGGGG
AACGAAAATAAGTATTTACTTATACACCAATCCCCTCACTATTTGCGGTAGTGAGGGG
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|