Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | SprA2-SprA2AS/- |
Location | 2481127..2481311 | Replicon | chromosome |
Accession | NZ_CP102970 | ||
Organism | Staphylococcus aureus strain 09-G-F |
Toxin (Protein)
Gene name | SprA2 | Uniprot ID | A0A2P7CQJ7 |
Locus tag | NW983_RS12335 | Protein ID | WP_000482647.1 |
Coordinates | 2481204..2481311 (-) | Length | 36 a.a. |
Antitoxin (RNA)
Gene name | SprA2AS | ||
Locus tag | - | ||
Coordinates | 2481127..2481187 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NW983_RS12325 (NW983_12325) | 2476976..2478709 | - | 1734 | WP_258411843.1 | ABC transporter ATP-binding protein | - |
NW983_RS12330 (NW983_12330) | 2478734..2480497 | - | 1764 | WP_001064814.1 | ABC transporter ATP-binding protein | - |
- | 2481127..2481187 | + | 61 | - | - | Antitoxin |
NW983_RS12335 (NW983_12335) | 2481204..2481311 | - | 108 | WP_000482647.1 | type I toxin-antitoxin system Fst family toxin | Toxin |
NW983_RS12340 (NW983_12340) | 2481446..2481832 | - | 387 | WP_000779360.1 | flippase GtxA | - |
NW983_RS12345 (NW983_12345) | 2482090..2483232 | + | 1143 | WP_216804653.1 | glycerate kinase | - |
NW983_RS12350 (NW983_12350) | 2483292..2483951 | + | 660 | WP_000831298.1 | membrane protein | - |
NW983_RS12355 (NW983_12355) | 2484133..2485344 | + | 1212 | WP_001192075.1 | multidrug effflux MFS transporter | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Prophage | - | sbi / hlgA / hlgC / hlgB | 2455066..2488625 | 33559 | |
- | flank | IS/Tn | - | - | 2475241..2476887 | 1646 | |
- | flank | IS/Tn | - | - | 2485643..2487289 | 1646 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 36 a.a. Molecular weight: 4012.76 Da Isoelectric Point: 10.4935
>T254736 WP_000482647.1 NZ_CP102970:c2481311-2481204 [Staphylococcus aureus]
MFNLLIDIMTSALSGCLVAFFAHWLRTRNNKKGDK
MFNLLIDIMTSALSGCLVAFFAHWLRTRNNKKGDK
Download Length: 108 bp
Antitoxin
Download Length: 61 bp
>AT254736 NZ_CP102970:2481127-2481187 [Staphylococcus aureus]
TACATAATAAATTGAACATCTAAATACACCAAATCCCCTCACTACTGCCATAGTGAGGGGA
TACATAATAAATTGAACATCTAAATACACCAAATCCCCTCACTACTGCCATAGTGAGGGGA
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|