Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | SprG3-sprA1AS/- |
| Location | 2131906..2132104 | Replicon | chromosome |
| Accession | NZ_CP102970 | ||
| Organism | Staphylococcus aureus strain 09-G-F | ||
Toxin (Protein)
| Gene name | SprG3 | Uniprot ID | - |
| Locus tag | NW983_RS10455 | Protein ID | WP_075583739.1 |
| Coordinates | 2132000..2132104 (-) | Length | 35 a.a. |
Antitoxin (RNA)
| Gene name | sprA1AS | ||
| Locus tag | - | ||
| Coordinates | 2131906..2131944 (+) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NW983_RS10430 (NW983_10430) | 2128021..2128686 | - | 666 | WP_001024095.1 | SDR family oxidoreductase | - |
| NW983_RS10435 (NW983_10435) | 2128838..2129158 | + | 321 | WP_000003759.1 | Zn(II)-responsive metalloregulatory transcriptional repressor CzrA | - |
| NW983_RS10440 (NW983_10440) | 2129160..2130137 | + | 978 | WP_000019734.1 | CDF family zinc efflux transporter CzrB | - |
| NW983_RS10445 (NW983_10445) | 2130403..2131494 | + | 1092 | WP_061838836.1 | hypothetical protein | - |
| NW983_RS10450 (NW983_10450) | 2131886..2131960 | + | 75 | Protein_2015 | hypothetical protein | - |
| - | 2131906..2131944 | + | 39 | - | - | Antitoxin |
| NW983_RS10455 (NW983_10455) | 2132000..2132104 | - | 105 | WP_075583739.1 | hypothetical protein | Toxin |
| NW983_RS10460 (NW983_10460) | 2132202..2132363 | - | 162 | Protein_2017 | helix-turn-helix domain-containing protein | - |
| NW983_RS10465 (NW983_10465) | 2132781..2132939 | + | 159 | WP_024928151.1 | hypothetical protein | - |
| NW983_RS10470 (NW983_10470) | 2133387..2133479 | + | 93 | WP_000142674.1 | hypothetical protein | - |
| NW983_RS10475 (NW983_10475) | 2133600..2134457 | - | 858 | WP_000370921.1 | HAD family hydrolase | - |
| NW983_RS10480 (NW983_10480) | 2134525..2135307 | - | 783 | WP_000908178.1 | ABC transporter ATP-binding protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 35 a.a. Molecular weight: 3861.73 Da Isoelectric Point: 7.0039
>T254732 WP_075583739.1 NZ_CP102970:c2132104-2132000 [Staphylococcus aureus]
MLLLERTSMSDFEMLMVVLTIIGLVLISNQGHKK
MLLLERTSMSDFEMLMVVLTIIGLVLISNQGHKK
Download Length: 105 bp
Antitoxin
Download Length: 39 bp
>AT254732 NZ_CP102970:2131906-2131944 [Staphylococcus aureus]
AACATGTTACCCTAATGAGCCCGTTAAAAAGACGGTGAC
AACATGTTACCCTAATGAGCCCGTTAAAAAGACGGTGAC
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|