Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | sprA1-sprA1AS/- |
| Location | 1860753..1860933 | Replicon | chromosome |
| Accession | NZ_CP102970 | ||
| Organism | Staphylococcus aureus strain 09-G-F | ||
Toxin (Protein)
| Gene name | sprA1 | Uniprot ID | - |
| Locus tag | NW983_RS08900 | Protein ID | WP_001801861.1 |
| Coordinates | 1860753..1860848 (+) | Length | 32 a.a. |
Antitoxin (RNA)
| Gene name | sprA1AS | ||
| Locus tag | - | ||
| Coordinates | 1860876..1860933 (-) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NW983_RS08860 (NW983_08860) | 1856189..1856818 | - | 630 | WP_258411724.1 | ImmA/IrrE family metallo-endopeptidase | - |
| NW983_RS08865 (NW983_08865) | 1856932..1857117 | - | 186 | WP_000809857.1 | hypothetical protein | - |
| NW983_RS08870 (NW983_08870) | 1857119..1857295 | - | 177 | WP_000375476.1 | hypothetical protein | - |
| NW983_RS08875 (NW983_08875) | 1857306..1857689 | - | 384 | WP_258411725.1 | hypothetical protein | - |
| NW983_RS08880 (NW983_08880) | 1857791..1858096 | - | 306 | WP_258411726.1 | IS3 family transposase | - |
| NW983_RS08885 (NW983_08885) | 1858308..1859069 | - | 762 | WP_001066123.1 | IS21-like element helper ATPase IstB | - |
| NW983_RS08890 (NW983_08890) | 1859062..1860354 | - | 1293 | WP_000777472.1 | IS21 family transposase | - |
| NW983_RS08895 (NW983_08895) | 1860389..1860625 | - | 237 | WP_258411727.1 | transposase | - |
| NW983_RS08900 (NW983_08900) | 1860753..1860848 | + | 96 | WP_001801861.1 | type I toxin-antitoxin system Fst family toxin PepA1 | Toxin |
| - | 1860876..1860933 | - | 58 | - | - | Antitoxin |
| NW983_RS08905 (NW983_08905) | 1860971..1861072 | + | 102 | WP_001791232.1 | hypothetical protein | - |
| NW983_RS08910 (NW983_08910) | 1861247..1861690 | - | 444 | WP_086153312.1 | DUF1433 domain-containing protein | - |
| NW983_RS08915 (NW983_08915) | 1861690..1862133 | - | 444 | WP_000439996.1 | DUF1433 domain-containing protein | - |
| NW983_RS08920 (NW983_08920) | 1862176..1863786 | + | 1611 | WP_258411728.1 | lipase | - |
| NW983_RS08925 (NW983_08925) | 1863801..1864100 | + | 300 | WP_000095392.1 | WXG100 family type VII secretion target | - |
| NW983_RS08930 (NW983_08930) | 1864337..1865596 | - | 1260 | WP_258411729.1 | restriction endonuclease subunit S | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Prophage | - | lukD / hlgA | 1851752..1882762 | 31010 | |
| - | flank | IS/Tn | - | - | 1858308..1859072 | 764 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 32 a.a. Molecular weight: 3554.32 Da Isoelectric Point: 10.4449
>T254728 WP_001801861.1 NZ_CP102970:1860753-1860848 [Staphylococcus aureus]
VMLIFVHIIAPVISGCAIAFFSYWLSRRNTK
VMLIFVHIIAPVISGCAIAFFSYWLSRRNTK
Download Length: 96 bp
Antitoxin
Download Length: 58 bp
>AT254728 NZ_CP102970:c1860933-1860876 [Staphylococcus aureus]
AACGAAAATAAGTATTTACTTATACACCAATCCCCTCACTATTTGCGGTAGTGAGGGG
AACGAAAATAAGTATTTACTTATACACCAATCCCCTCACTATTTGCGGTAGTGAGGGG
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
