Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | SprA2-SprA2AS/- |
Location | 2401394..2401578 | Replicon | chromosome |
Accession | NZ_CP102968 | ||
Organism | Staphylococcus aureus strain 13-G-52 |
Toxin (Protein)
Gene name | SprA2 | Uniprot ID | A0A2U0ISP5 |
Locus tag | NW965_RS11755 | Protein ID | WP_000482652.1 |
Coordinates | 2401471..2401578 (-) | Length | 36 a.a. |
Antitoxin (RNA)
Gene name | SprA2AS | ||
Locus tag | - | ||
Coordinates | 2401394..2401454 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NW965_RS11740 (NW965_11735) | 2396849..2397016 | - | 168 | WP_001789205.1 | hypothetical protein | - |
NW965_RS11745 (NW965_11740) | 2397247..2398980 | - | 1734 | WP_049307645.1 | ABC transporter ATP-binding protein | - |
NW965_RS11750 (NW965_11745) | 2399005..2400768 | - | 1764 | WP_001064837.1 | ABC transporter ATP-binding protein | - |
- | 2401394..2401454 | + | 61 | - | - | Antitoxin |
NW965_RS11755 (NW965_11750) | 2401471..2401578 | - | 108 | WP_000482652.1 | type I toxin-antitoxin system Fst family toxin | Toxin |
NW965_RS11760 (NW965_11755) | 2401712..2402098 | - | 387 | WP_000779357.1 | flippase GtxA | - |
NW965_RS11765 (NW965_11760) | 2402366..2403508 | + | 1143 | WP_001176863.1 | glycerate kinase | - |
NW965_RS11770 (NW965_11765) | 2403568..2404227 | + | 660 | WP_000831298.1 | membrane protein | - |
NW965_RS11775 (NW965_11770) | 2404409..2405620 | + | 1212 | WP_001192075.1 | multidrug effflux MFS transporter | - |
NW965_RS11780 (NW965_11775) | 2405743..2406216 | - | 474 | WP_000456486.1 | GyrI-like domain-containing protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 36 a.a. Molecular weight: 4011.78 Da Isoelectric Point: 11.0582
>T254725 WP_000482652.1 NZ_CP102968:c2401578-2401471 [Staphylococcus aureus]
MFNLLINIMTSALSGCLVAFFAHWLRTRNNKKGDK
MFNLLINIMTSALSGCLVAFFAHWLRTRNNKKGDK
Download Length: 108 bp
Antitoxin
Download Length: 61 bp
>AT254725 NZ_CP102968:2401394-2401454 [Staphylococcus aureus]
TACATAATAAATTGAACATCTAAATACACCAAATCCCCTCACTACTGCCATAGTGAGGGGA
TACATAATAAATTGAACATCTAAATACACCAAATCCCCTCACTACTGCCATAGTGAGGGGA
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|