Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | sprA1-sprA1AS/- |
| Location | 1808387..1808567 | Replicon | chromosome |
| Accession | NZ_CP102968 | ||
| Organism | Staphylococcus aureus strain 13-G-52 | ||
Toxin (Protein)
| Gene name | sprA1 | Uniprot ID | - |
| Locus tag | NW965_RS08550 | Protein ID | WP_001801861.1 |
| Coordinates | 1808387..1808482 (+) | Length | 32 a.a. |
Antitoxin (RNA)
| Gene name | sprA1AS | ||
| Locus tag | - | ||
| Coordinates | 1808510..1808567 (-) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NW965_RS08515 (NW965_08510) | 1804155..1804781 | + | 627 | WP_045177256.1 | hypothetical protein | - |
| NW965_RS08520 (NW965_08515) | 1804822..1805163 | + | 342 | WP_045177258.1 | DUF3969 family protein | - |
| NW965_RS08525 (NW965_08520) | 1805264..1805836 | + | 573 | WP_045177260.1 | hypothetical protein | - |
| NW965_RS08530 (NW965_08525) | 1806034..1806662 | - | 629 | Protein_1675 | ImmA/IrrE family metallo-endopeptidase | - |
| NW965_RS08535 (NW965_08535) | 1806965..1807141 | - | 177 | WP_000375477.1 | hypothetical protein | - |
| NW965_RS08540 (NW965_08540) | 1807152..1807535 | - | 384 | WP_000070811.1 | hypothetical protein | - |
| NW965_RS08545 (NW965_08545) | 1807978..1808259 | - | 282 | WP_258414718.1 | transposase | - |
| NW965_RS08550 (NW965_08550) | 1808387..1808482 | + | 96 | WP_001801861.1 | type I toxin-antitoxin system Fst family toxin PepA1 | Toxin |
| - | 1808510..1808567 | - | 58 | - | - | Antitoxin |
| NW965_RS08555 (NW965_08555) | 1808605..1808706 | + | 102 | WP_001791232.1 | hypothetical protein | - |
| NW965_RS08560 (NW965_08560) | 1808881..1809324 | - | 444 | WP_086153312.1 | DUF1433 domain-containing protein | - |
| NW965_RS08565 (NW965_08565) | 1809324..1809767 | - | 444 | WP_000439996.1 | DUF1433 domain-containing protein | - |
| NW965_RS08570 (NW965_08570) | 1809810..1811420 | + | 1611 | WP_258411728.1 | lipase | - |
| NW965_RS08575 (NW965_08575) | 1811435..1811734 | + | 300 | WP_000095392.1 | WXG100 family type VII secretion target | - |
| NW965_RS08580 (NW965_08580) | 1811971..1813230 | - | 1260 | WP_258411729.1 | restriction endonuclease subunit S | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 32 a.a. Molecular weight: 3554.32 Da Isoelectric Point: 10.4449
>T254719 WP_001801861.1 NZ_CP102968:1808387-1808482 [Staphylococcus aureus]
VMLIFVHIIAPVISGCAIAFFSYWLSRRNTK
VMLIFVHIIAPVISGCAIAFFSYWLSRRNTK
Download Length: 96 bp
Antitoxin
Download Length: 58 bp
>AT254719 NZ_CP102968:c1808567-1808510 [Staphylococcus aureus]
AACGAAAATAAGTATTTACTTATACACCAATCCCCTCACTATTTGCGGTAGTGAGGGG
AACGAAAATAAGTATTTACTTATACACCAATCCCCTCACTATTTGCGGTAGTGAGGGG
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
