Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | SprA2-SprA2AS/- |
| Location | 2423188..2423372 | Replicon | chromosome |
| Accession | NZ_CP102967 | ||
| Organism | Staphylococcus aureus strain 17-H-61 | ||
Toxin (Protein)
| Gene name | SprA2 | Uniprot ID | A0A2U0ISP5 |
| Locus tag | NW947_RS12000 | Protein ID | WP_000482652.1 |
| Coordinates | 2423265..2423372 (-) | Length | 36 a.a. |
Antitoxin (RNA)
| Gene name | SprA2AS | ||
| Locus tag | - | ||
| Coordinates | 2423188..2423248 (+) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NW947_RS11985 (NW947_11985) | 2418643..2418810 | - | 168 | WP_250755633.1 | hypothetical protein | - |
| NW947_RS11990 (NW947_11990) | 2419041..2420774 | - | 1734 | WP_000486494.1 | ABC transporter ATP-binding protein | - |
| NW947_RS11995 (NW947_11995) | 2420799..2422562 | - | 1764 | WP_258416336.1 | ABC transporter ATP-binding protein | - |
| - | 2423188..2423248 | + | 61 | - | - | Antitoxin |
| NW947_RS12000 (NW947_12000) | 2423265..2423372 | - | 108 | WP_000482652.1 | type I toxin-antitoxin system Fst family toxin | Toxin |
| NW947_RS12005 (NW947_12005) | 2423506..2423892 | - | 387 | WP_000779360.1 | flippase GtxA | - |
| NW947_RS12010 (NW947_12010) | 2424150..2425292 | + | 1143 | WP_001176863.1 | glycerate kinase | - |
| NW947_RS12015 (NW947_12015) | 2425352..2426005 | + | 654 | WP_053012342.1 | hypothetical protein | - |
| NW947_RS12020 (NW947_12020) | 2426187..2427398 | + | 1212 | WP_001191923.1 | multidrug effflux MFS transporter | - |
| NW947_RS12025 (NW947_12025) | 2427521..2427994 | - | 474 | WP_000456486.1 | GyrI-like domain-containing protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 36 a.a. Molecular weight: 4011.78 Da Isoelectric Point: 11.0582
>T254716 WP_000482652.1 NZ_CP102967:c2423372-2423265 [Staphylococcus aureus]
MFNLLINIMTSALSGCLVAFFAHWLRTRNNKKGDK
MFNLLINIMTSALSGCLVAFFAHWLRTRNNKKGDK
Download Length: 108 bp
Antitoxin
Download Length: 61 bp
>AT254716 NZ_CP102967:2423188-2423248 [Staphylococcus aureus]
TACATAATAAATTGAACATCTAAATACACCAAATCCCCTCACTACTGCCATAGTGAGGGGA
TACATAATAAATTGAACATCTAAATACACCAAATCCCCTCACTACTGCCATAGTGAGGGGA
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|