Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | SprA2-SprA2AS/- |
Location | 2442455..2442639 | Replicon | chromosome |
Accession | NZ_CP102966 | ||
Organism | Staphylococcus aureus strain 29-P-01 |
Toxin (Protein)
Gene name | SprA2 | Uniprot ID | A0A2U0ISP5 |
Locus tag | NW955_RS12100 | Protein ID | WP_000482652.1 |
Coordinates | 2442532..2442639 (-) | Length | 36 a.a. |
Antitoxin (RNA)
Gene name | SprA2AS | ||
Locus tag | - | ||
Coordinates | 2442455..2442515 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NW955_RS12085 (NW955_12085) | 2437910..2438077 | - | 168 | WP_001789205.1 | hypothetical protein | - |
NW955_RS12090 (NW955_12090) | 2438308..2440041 | - | 1734 | WP_049307645.1 | ABC transporter ATP-binding protein | - |
NW955_RS12095 (NW955_12095) | 2440066..2441829 | - | 1764 | WP_001064837.1 | ABC transporter ATP-binding protein | - |
- | 2442455..2442515 | + | 61 | - | - | Antitoxin |
NW955_RS12100 (NW955_12100) | 2442532..2442639 | - | 108 | WP_000482652.1 | type I toxin-antitoxin system Fst family toxin | Toxin |
NW955_RS12105 (NW955_12105) | 2442773..2443159 | - | 387 | WP_000779357.1 | flippase GtxA | - |
NW955_RS12110 (NW955_12110) | 2443427..2444569 | + | 1143 | WP_001176863.1 | glycerate kinase | - |
NW955_RS12115 (NW955_12115) | 2444629..2445288 | + | 660 | WP_000831298.1 | membrane protein | - |
NW955_RS12120 (NW955_12120) | 2445470..2446681 | + | 1212 | WP_001192075.1 | multidrug effflux MFS transporter | - |
NW955_RS12125 (NW955_12125) | 2446804..2447277 | - | 474 | WP_258412664.1 | GyrI-like domain-containing protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 36 a.a. Molecular weight: 4011.78 Da Isoelectric Point: 11.0582
>T254709 WP_000482652.1 NZ_CP102966:c2442639-2442532 [Staphylococcus aureus]
MFNLLINIMTSALSGCLVAFFAHWLRTRNNKKGDK
MFNLLINIMTSALSGCLVAFFAHWLRTRNNKKGDK
Download Length: 108 bp
Antitoxin
Download Length: 61 bp
>AT254709 NZ_CP102966:2442455-2442515 [Staphylococcus aureus]
TACATAATAAATTGAACATCTAAATACACCAAATCCCCTCACTACTGCCATAGTGAGGGGA
TACATAATAAATTGAACATCTAAATACACCAAATCCCCTCACTACTGCCATAGTGAGGGGA
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|