Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | SprG3-sprA1AS/- |
Location | 2145838..2146035 | Replicon | chromosome |
Accession | NZ_CP102966 | ||
Organism | Staphylococcus aureus strain 29-P-01 |
Toxin (Protein)
Gene name | SprG3 | Uniprot ID | Q2FWA7 |
Locus tag | NW955_RS10565 | Protein ID | WP_001802298.1 |
Coordinates | 2145931..2146035 (-) | Length | 35 a.a. |
Antitoxin (RNA)
Gene name | sprA1AS | ||
Locus tag | - | ||
Coordinates | 2145838..2145876 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NW955_RS10540 (NW955_10540) | 2141956..2142621 | - | 666 | WP_001024095.1 | SDR family oxidoreductase | - |
NW955_RS10545 (NW955_10545) | 2142773..2143093 | + | 321 | WP_000003759.1 | Zn(II)-responsive metalloregulatory transcriptional repressor CzrA | - |
NW955_RS10550 (NW955_10550) | 2143095..2144075 | + | 981 | WP_000019744.1 | CDF family zinc efflux transporter CzrB | - |
NW955_RS10555 (NW955_10555) | 2144341..2145432 | + | 1092 | WP_258412250.1 | transcriptional regulator | - |
NW955_RS10560 (NW955_10560) | 2145818..2145892 | + | 75 | Protein_2037 | hypothetical protein | - |
- | 2145838..2145876 | + | 39 | - | - | Antitoxin |
NW955_RS10565 (NW955_10565) | 2145931..2146035 | - | 105 | WP_001802298.1 | hypothetical protein | Toxin |
NW955_RS10570 (NW955_10570) | 2146552..2146722 | + | 171 | WP_001792292.1 | transposase | - |
NW955_RS10575 (NW955_10575) | 2146715..2146873 | + | 159 | WP_001792784.1 | hypothetical protein | - |
NW955_RS10580 (NW955_10580) | 2147531..2148388 | - | 858 | WP_000370925.1 | Cof-type HAD-IIB family hydrolase | - |
NW955_RS10585 (NW955_10585) | 2148456..2149238 | - | 783 | WP_258412620.1 | ABC transporter ATP-binding protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 35 a.a. Molecular weight: 3906.77 Da Isoelectric Point: 5.5724
>T254707 WP_001802298.1 NZ_CP102966:c2146035-2145931 [Staphylococcus aureus]
MLLLERTSMSDFEMLMVVLTIIGLVLISTQDHKK
MLLLERTSMSDFEMLMVVLTIIGLVLISTQDHKK
Download Length: 105 bp
Antitoxin
Download Length: 39 bp
>AT254707 NZ_CP102966:2145838-2145876 [Staphylococcus aureus]
AACATGTTACCCTAATGAGCCCGTTAAAAAGACGGTGAC
AACATGTTACCCTAATGAGCCCGTTAAAAAGACGGTGAC
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|