Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | sprA1-sprA1AS/- |
| Location | 1855922..1856102 | Replicon | chromosome |
| Accession | NZ_CP102966 | ||
| Organism | Staphylococcus aureus strain 29-P-01 | ||
Toxin (Protein)
| Gene name | sprA1 | Uniprot ID | - |
| Locus tag | NW955_RS08925 | Protein ID | WP_001801861.1 |
| Coordinates | 1855922..1856017 (+) | Length | 32 a.a. |
Antitoxin (RNA)
| Gene name | sprA1AS | ||
| Locus tag | - | ||
| Coordinates | 1856045..1856102 (-) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NW955_RS08885 (NW955_08885) | 1851684..1852310 | + | 627 | WP_045177256.1 | hypothetical protein | - |
| NW955_RS08890 (NW955_08890) | 1852351..1852692 | + | 342 | WP_045177258.1 | DUF3969 family protein | - |
| NW955_RS08895 (NW955_08895) | 1852793..1853365 | + | 573 | WP_045177260.1 | hypothetical protein | - |
| NW955_RS08900 (NW955_08900) | 1853563..1854191 | - | 629 | Protein_1749 | ImmA/IrrE family metallo-endopeptidase | - |
| NW955_RS08905 (NW955_08905) | 1854494..1854670 | - | 177 | WP_000375477.1 | hypothetical protein | - |
| NW955_RS08910 (NW955_08910) | 1854681..1855064 | - | 384 | WP_000070811.1 | hypothetical protein | - |
| NW955_RS08915 (NW955_08915) | 1855166..1855471 | - | 306 | WP_258411726.1 | IS3 family transposase | - |
| NW955_RS08920 (NW955_08920) | 1855513..1855794 | - | 282 | WP_258412590.1 | transposase | - |
| NW955_RS08925 (NW955_08925) | 1855922..1856017 | + | 96 | WP_001801861.1 | type I toxin-antitoxin system Fst family toxin PepA1 | Toxin |
| - | 1856045..1856102 | - | 58 | - | - | Antitoxin |
| NW955_RS08930 (NW955_08930) | 1856140..1856241 | + | 102 | WP_001791232.1 | hypothetical protein | - |
| NW955_RS08935 (NW955_08935) | 1856416..1856859 | - | 444 | WP_086153312.1 | DUF1433 domain-containing protein | - |
| NW955_RS08940 (NW955_08940) | 1856859..1857302 | - | 444 | WP_000439996.1 | DUF1433 domain-containing protein | - |
| NW955_RS08945 (NW955_08945) | 1857345..1858955 | + | 1611 | WP_258411728.1 | lipase | - |
| NW955_RS08950 (NW955_08950) | 1858970..1859269 | + | 300 | WP_000095392.1 | WXG100 family type VII secretion target | - |
| NW955_RS08955 (NW955_08955) | 1859506..1860765 | - | 1260 | WP_258412591.1 | restriction endonuclease subunit S | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Prophage | - | lukD / hlgA | 1824738..1913981 | 89243 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 32 a.a. Molecular weight: 3554.32 Da Isoelectric Point: 10.4449
>T254703 WP_001801861.1 NZ_CP102966:1855922-1856017 [Staphylococcus aureus]
VMLIFVHIIAPVISGCAIAFFSYWLSRRNTK
VMLIFVHIIAPVISGCAIAFFSYWLSRRNTK
Download Length: 96 bp
Antitoxin
Download Length: 58 bp
>AT254703 NZ_CP102966:c1856102-1856045 [Staphylococcus aureus]
AACGAAAATAAGTATTTACTTATACACCAATCCCCTCACTATTTGCGGTAGTGAGGGG
AACGAAAATAAGTATTTACTTATACACCAATCCCCTCACTATTTGCGGTAGTGAGGGG
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
