Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | SprA2-SprA2AS/- |
| Location | 2501134..2501318 | Replicon | chromosome |
| Accession | NZ_CP102963 | ||
| Organism | Staphylococcus aureus strain 40-B-50 | ||
Toxin (Protein)
| Gene name | SprA2 | Uniprot ID | A0A2U0ISP5 |
| Locus tag | NW941_RS12540 | Protein ID | WP_000482652.1 |
| Coordinates | 2501211..2501318 (-) | Length | 36 a.a. |
Antitoxin (RNA)
| Gene name | SprA2AS | ||
| Locus tag | - | ||
| Coordinates | 2501134..2501194 (+) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NW941_RS12525 (NW941_12560) | 2496664..2496831 | - | 168 | WP_031860495.1 | hypothetical protein | - |
| NW941_RS12530 (NW941_12565) | 2497062..2498795 | - | 1734 | WP_000486494.1 | ABC transporter ATP-binding protein | - |
| NW941_RS12535 (NW941_12570) | 2498820..2500583 | - | 1764 | WP_064136629.1 | ABC transporter ATP-binding protein | - |
| - | 2501134..2501194 | + | 61 | - | - | Antitoxin |
| NW941_RS12540 (NW941_12575) | 2501211..2501318 | - | 108 | WP_000482652.1 | type I toxin-antitoxin system Fst family toxin | Toxin |
| NW941_RS12545 (NW941_12580) | 2501452..2501838 | - | 387 | WP_000779358.1 | flippase GtxA | - |
| NW941_RS12550 (NW941_12585) | 2502106..2503248 | + | 1143 | WP_001176863.1 | glycerate kinase | - |
| NW941_RS12555 (NW941_12590) | 2503308..2503967 | + | 660 | WP_000831298.1 | membrane protein | - |
| NW941_RS12560 (NW941_12595) | 2504149..2505360 | + | 1212 | WP_001192075.1 | multidrug effflux MFS transporter | - |
| NW941_RS12565 (NW941_12600) | 2505483..2505956 | - | 474 | WP_043044951.1 | GyrI-like domain-containing protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 36 a.a. Molecular weight: 4011.78 Da Isoelectric Point: 11.0582
>T254698 WP_000482652.1 NZ_CP102963:c2501318-2501211 [Staphylococcus aureus]
MFNLLINIMTSALSGCLVAFFAHWLRTRNNKKGDK
MFNLLINIMTSALSGCLVAFFAHWLRTRNNKKGDK
Download Length: 108 bp
Antitoxin
Download Length: 61 bp
>AT254698 NZ_CP102963:2501134-2501194 [Staphylococcus aureus]
TACATAATAAATTGAACATCTAAATACACCAAATCCCCTCACTACTGCCATAGTGAGGGGA
TACATAATAAATTGAACATCTAAATACACCAAATCCCCTCACTACTGCCATAGTGAGGGGA
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|