Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | sprA1-sprA1AS/- |
| Location | 1893267..1893447 | Replicon | chromosome |
| Accession | NZ_CP102963 | ||
| Organism | Staphylococcus aureus strain 40-B-50 | ||
Toxin (Protein)
| Gene name | sprA1 | Uniprot ID | - |
| Locus tag | NW941_RS09155 | Protein ID | WP_001801861.1 |
| Coordinates | 1893267..1893362 (+) | Length | 32 a.a. |
Antitoxin (RNA)
| Gene name | sprA1AS | ||
| Locus tag | - | ||
| Coordinates | 1893390..1893447 (-) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NW941_RS09115 (NW941_09145) | 1889029..1889655 | + | 627 | WP_045177256.1 | hypothetical protein | - |
| NW941_RS09120 (NW941_09150) | 1889696..1890037 | + | 342 | WP_045177258.1 | DUF3969 family protein | - |
| NW941_RS09125 (NW941_09155) | 1890138..1890710 | + | 573 | WP_045177260.1 | hypothetical protein | - |
| NW941_RS09130 (NW941_09160) | 1890908..1891536 | - | 629 | Protein_1795 | ImmA/IrrE family metallo-endopeptidase | - |
| NW941_RS09135 (NW941_09165) | 1891839..1892015 | - | 177 | WP_000375477.1 | hypothetical protein | - |
| NW941_RS09140 (NW941_09170) | 1892026..1892409 | - | 384 | WP_000070811.1 | hypothetical protein | - |
| NW941_RS09145 (NW941_09175) | 1892511..1892816 | - | 306 | WP_258411726.1 | IS3 family transposase | - |
| NW941_RS09150 (NW941_09180) | 1892858..1893139 | - | 282 | WP_258412590.1 | transposase | - |
| NW941_RS09155 (NW941_09185) | 1893267..1893362 | + | 96 | WP_001801861.1 | type I toxin-antitoxin system Fst family toxin PepA1 | Toxin |
| - | 1893390..1893447 | - | 58 | - | - | Antitoxin |
| NW941_RS09160 (NW941_09190) | 1893485..1893586 | + | 102 | WP_001791232.1 | hypothetical protein | - |
| NW941_RS09165 (NW941_09195) | 1893761..1894204 | - | 444 | WP_086153312.1 | DUF1433 domain-containing protein | - |
| NW941_RS09170 (NW941_09200) | 1894204..1894647 | - | 444 | WP_000439996.1 | DUF1433 domain-containing protein | - |
| NW941_RS09175 (NW941_09205) | 1894690..1896300 | + | 1611 | WP_258411728.1 | lipase | - |
| NW941_RS09180 (NW941_09210) | 1896315..1896614 | + | 300 | WP_000095392.1 | WXG100 family type VII secretion target | - |
| NW941_RS09185 (NW941_09215) | 1896851..1898110 | - | 1260 | WP_258411729.1 | restriction endonuclease subunit S | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 32 a.a. Molecular weight: 3554.32 Da Isoelectric Point: 10.4449
>T254691 WP_001801861.1 NZ_CP102963:1893267-1893362 [Staphylococcus aureus]
VMLIFVHIIAPVISGCAIAFFSYWLSRRNTK
VMLIFVHIIAPVISGCAIAFFSYWLSRRNTK
Download Length: 96 bp
Antitoxin
Download Length: 58 bp
>AT254691 NZ_CP102963:c1893447-1893390 [Staphylococcus aureus]
AACGAAAATAAGTATTTACTTATACACCAATCCCCTCACTATTTGCGGTAGTGAGGGG
AACGAAAATAAGTATTTACTTATACACCAATCCCCTCACTATTTGCGGTAGTGAGGGG
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
