Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | SprA2-SprA2AS/- |
| Location | 2513334..2513518 | Replicon | chromosome |
| Accession | NZ_CP102962 | ||
| Organism | Staphylococcus aureus strain 16CS0212 | ||
Toxin (Protein)
| Gene name | SprA2 | Uniprot ID | A0A2P7CQJ7 |
| Locus tag | NW971_RS12610 | Protein ID | WP_000482647.1 |
| Coordinates | 2513411..2513518 (-) | Length | 36 a.a. |
Antitoxin (RNA)
| Gene name | SprA2AS | ||
| Locus tag | - | ||
| Coordinates | 2513334..2513394 (+) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NW971_RS12595 (NW971_12595) | 2508788..2508955 | - | 168 | WP_001789205.1 | hypothetical protein | - |
| NW971_RS12600 (NW971_12600) | 2509186..2510919 | - | 1734 | WP_258464492.1 | ABC transporter ATP-binding protein | - |
| NW971_RS12605 (NW971_12605) | 2510944..2512707 | - | 1764 | WP_258464493.1 | ABC transporter ATP-binding protein | - |
| - | 2513334..2513394 | + | 61 | - | - | Antitoxin |
| NW971_RS12610 (NW971_12610) | 2513411..2513518 | - | 108 | WP_000482647.1 | type I toxin-antitoxin system Fst family toxin | Toxin |
| NW971_RS12615 (NW971_12615) | 2513652..2514038 | - | 387 | WP_000779353.1 | flippase GtxA | - |
| NW971_RS12620 (NW971_12620) | 2514306..2515448 | + | 1143 | WP_001176863.1 | glycerate kinase | - |
| NW971_RS12625 (NW971_12625) | 2515508..2516167 | + | 660 | WP_000831304.1 | hypothetical protein | - |
| NW971_RS12630 (NW971_12630) | 2516350..2517561 | + | 1212 | WP_258464494.1 | multidrug effflux MFS transporter | - |
| NW971_RS12635 (NW971_12635) | 2517684..2518157 | - | 474 | WP_258464495.1 | GyrI-like domain-containing protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 36 a.a. Molecular weight: 4012.76 Da Isoelectric Point: 10.4935
>T254687 WP_000482647.1 NZ_CP102962:c2513518-2513411 [Staphylococcus aureus]
MFNLLIDIMTSALSGCLVAFFAHWLRTRNNKKGDK
MFNLLIDIMTSALSGCLVAFFAHWLRTRNNKKGDK
Download Length: 108 bp
Antitoxin
Download Length: 61 bp
>AT254687 NZ_CP102962:2513334-2513394 [Staphylococcus aureus]
TACATAATAAATTGAACATCTAAATACACCAAATCCCCTCACTACTGCCATAGTGAGGGGA
TACATAATAAATTGAACATCTAAATACACCAAATCCCCTCACTACTGCCATAGTGAGGGGA
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|