Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | SprG3-sprA1AS/- |
Location | 2213622..2213820 | Replicon | chromosome |
Accession | NZ_CP102962 | ||
Organism | Staphylococcus aureus strain 16CS0212 |
Toxin (Protein)
Gene name | SprG3 | Uniprot ID | Q2FWA7 |
Locus tag | NW971_RS11045 | Protein ID | WP_001802298.1 |
Coordinates | 2213716..2213820 (-) | Length | 35 a.a. |
Antitoxin (RNA)
Gene name | sprA1AS | ||
Locus tag | - | ||
Coordinates | 2213622..2213660 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NW971_RS11025 (NW971_11025) | 2209593..2210258 | - | 666 | WP_001024100.1 | SDR family oxidoreductase | - |
NW971_RS11030 (NW971_11030) | 2210410..2210730 | + | 321 | WP_000003759.1 | Zn(II)-responsive metalloregulatory transcriptional repressor CzrA | - |
NW971_RS11035 (NW971_11035) | 2210732..2211709 | + | 978 | WP_000019731.1 | CDF family zinc efflux transporter CzrB | - |
NW971_RS11040 (NW971_11040) | 2211975..2213066 | + | 1092 | WP_000495691.1 | hypothetical protein | - |
- | 2213622..2213660 | + | 39 | - | - | Antitoxin |
NW971_RS11045 (NW971_11045) | 2213716..2213820 | - | 105 | WP_001802298.1 | hypothetical protein | Toxin |
NW971_RS11050 (NW971_11050) | 2213981..2214464 | - | 484 | Protein_2136 | recombinase family protein | - |
NW971_RS11055 (NW971_11055) | 2214507..2215642 | - | 1136 | Protein_2137 | SAP domain-containing protein | - |
NW971_RS11065 (NW971_11065) | 2216691..2217548 | - | 858 | WP_258464431.1 | HAD family hydrolase | - |
NW971_RS11070 (NW971_11070) | 2217615..2218397 | - | 783 | WP_258464432.1 | ABC transporter ATP-binding protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 35 a.a. Molecular weight: 3906.77 Da Isoelectric Point: 5.5724
>T254685 WP_001802298.1 NZ_CP102962:c2213820-2213716 [Staphylococcus aureus]
MLLLERTSMSDFEMLMVVLTIIGLVLISTQDHKK
MLLLERTSMSDFEMLMVVLTIIGLVLISTQDHKK
Download Length: 105 bp
Antitoxin
Download Length: 39 bp
>AT254685 NZ_CP102962:2213622-2213660 [Staphylococcus aureus]
AACATGTTACCCTAATGAGCCCGTTAAAAAGACGGTGAC
AACATGTTACCCTAATGAGCCCGTTAAAAAGACGGTGAC
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|