Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | sprA1-sprA1AS/- |
Location | 1920264..1920444 | Replicon | chromosome |
Accession | NZ_CP102962 | ||
Organism | Staphylococcus aureus strain 16CS0212 |
Toxin (Protein)
Gene name | sprA1 | Uniprot ID | - |
Locus tag | NW971_RS09415 | Protein ID | WP_001801861.1 |
Coordinates | 1920264..1920359 (+) | Length | 32 a.a. |
Antitoxin (RNA)
Gene name | sprA1AS | ||
Locus tag | - | ||
Coordinates | 1920387..1920444 (-) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NW971_RS09370 (NW971_09370) | 1916206..1916832 | + | 627 | WP_258464341.1 | hypothetical protein | - |
NW971_RS09375 (NW971_09375) | 1916873..1917214 | + | 342 | WP_258464342.1 | DUF3969 family protein | - |
NW971_RS09380 (NW971_09380) | 1917315..1917887 | + | 573 | WP_258464343.1 | hypothetical protein | - |
NW971_RS09385 (NW971_09385) | 1918085..1918567 | - | 483 | Protein_1846 | ImmA/IrrE family metallo-endopeptidase | - |
NW971_RS09390 (NW971_09390) | 1918681..1918866 | - | 186 | WP_111762421.1 | hypothetical protein | - |
NW971_RS09395 (NW971_09395) | 1918868..1919044 | - | 177 | WP_000375478.1 | hypothetical protein | - |
NW971_RS09400 (NW971_09400) | 1919064..1919434 | - | 371 | Protein_1849 | hypothetical protein | - |
NW971_RS09405 (NW971_09405) | 1919536..1919841 | - | 306 | WP_258464344.1 | IS3 family transposase | - |
NW971_RS09410 (NW971_09410) | 1919961..1920119 | - | 159 | WP_258464345.1 | hypothetical protein | - |
NW971_RS09415 (NW971_09415) | 1920264..1920359 | + | 96 | WP_001801861.1 | type I toxin-antitoxin system Fst family toxin PepA1 | Toxin |
- | 1920387..1920444 | - | 58 | - | - | Antitoxin |
NW971_RS09420 (NW971_09420) | 1920482..1920577 | + | 96 | Protein_1853 | hypothetical protein | - |
NW971_RS09425 (NW971_09425) | 1920600..1920731 | + | 132 | WP_258464346.1 | hypothetical protein | - |
NW971_RS09430 (NW971_09430) | 1921286..1921729 | - | 444 | WP_258464347.1 | DUF1433 domain-containing protein | - |
NW971_RS09435 (NW971_09435) | 1921729..1922172 | - | 444 | WP_258464348.1 | DUF1433 domain-containing protein | - |
NW971_RS09440 (NW971_09440) | 1922697..1925117 | + | 2421 | WP_258464349.1 | polysaccharide lyase 8 family protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 32 a.a. Molecular weight: 3554.32 Da Isoelectric Point: 10.4449
>T254680 WP_001801861.1 NZ_CP102962:1920264-1920359 [Staphylococcus aureus]
VMLIFVHIIAPVISGCAIAFFSYWLSRRNTK
VMLIFVHIIAPVISGCAIAFFSYWLSRRNTK
Download Length: 96 bp
>T254680 NZ_CP102962:1920264-1920359 [Staphylococcus aureus]
GTGATGCTTATTTTCGTTCACATCATAGCACCAGTCATCAGTGGCTGTGCCATTGCGTTTTTTTCTTATTGGCTAAGTAG
ACGCAATACAAAATAG
GTGATGCTTATTTTCGTTCACATCATAGCACCAGTCATCAGTGGCTGTGCCATTGCGTTTTTTTCTTATTGGCTAAGTAG
ACGCAATACAAAATAG
Antitoxin
Download Length: 58 bp
>AT254680 NZ_CP102962:c1920444-1920387 [Staphylococcus aureus]
AACGAAAATAAGTATTTACTTATACACCAATCCCCTCACTATTTGCGGTAGTGAGGGG
AACGAAAATAAGTATTTACTTATACACCAATCCCCTCACTATTTGCGGTAGTGAGGGG
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|