Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | SprA2-SprA2AS/- |
Location | 2483632..2483816 | Replicon | chromosome |
Accession | NZ_CP102961 | ||
Organism | Staphylococcus aureus strain 03-RR-88 |
Toxin (Protein)
Gene name | SprA2 | Uniprot ID | A0A2P7CQJ7 |
Locus tag | NW973_RS12375 | Protein ID | WP_000482647.1 |
Coordinates | 2483709..2483816 (-) | Length | 36 a.a. |
Antitoxin (RNA)
Gene name | SprA2AS | ||
Locus tag | - | ||
Coordinates | 2483632..2483692 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NW973_RS12360 (NW973_12360) | 2479088..2479255 | - | 168 | WP_001790576.1 | hypothetical protein | - |
NW973_RS12365 (NW973_12365) | 2479486..2481219 | - | 1734 | WP_258410821.1 | ABC transporter ATP-binding protein | - |
NW973_RS12370 (NW973_12370) | 2481244..2483007 | - | 1764 | WP_258410822.1 | ABC transporter ATP-binding protein | - |
- | 2483632..2483692 | + | 61 | - | - | Antitoxin |
NW973_RS12375 (NW973_12375) | 2483709..2483816 | - | 108 | WP_000482647.1 | type I toxin-antitoxin system Fst family toxin | Toxin |
NW973_RS12380 (NW973_12380) | 2483950..2484336 | - | 387 | WP_258410823.1 | flippase GtxA | - |
NW973_RS12385 (NW973_12385) | 2484594..2485736 | + | 1143 | WP_001176863.1 | glycerate kinase | - |
NW973_RS12390 (NW973_12390) | 2485796..2486455 | + | 660 | WP_258410824.1 | hypothetical protein | - |
NW973_RS12395 (NW973_12395) | 2486638..2487849 | + | 1212 | WP_001191923.1 | multidrug effflux MFS transporter | - |
NW973_RS12400 (NW973_12400) | 2487972..2488445 | - | 474 | WP_000456489.1 | GyrI-like domain-containing protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 36 a.a. Molecular weight: 4012.76 Da Isoelectric Point: 10.4935
>T254673 WP_000482647.1 NZ_CP102961:c2483816-2483709 [Staphylococcus aureus]
MFNLLIDIMTSALSGCLVAFFAHWLRTRNNKKGDK
MFNLLIDIMTSALSGCLVAFFAHWLRTRNNKKGDK
Download Length: 108 bp
Antitoxin
Download Length: 61 bp
>AT254673 NZ_CP102961:2483632-2483692 [Staphylococcus aureus]
TACATAATAAATTGAACATCTAAATACACCAAATCCCCTCACTACTGCCATAGTGAGGGGA
TACATAATAAATTGAACATCTAAATACACCAAATCCCCTCACTACTGCCATAGTGAGGGGA
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|