Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | SprG3-sprA1AS/- |
Location | 2195940..2196137 | Replicon | chromosome |
Accession | NZ_CP102961 | ||
Organism | Staphylococcus aureus strain 03-RR-88 |
Toxin (Protein)
Gene name | SprG3 | Uniprot ID | Q2FWA7 |
Locus tag | NW973_RS10870 | Protein ID | WP_001802298.1 |
Coordinates | 2196033..2196137 (-) | Length | 35 a.a. |
Antitoxin (RNA)
Gene name | sprA1AS | ||
Locus tag | - | ||
Coordinates | 2195940..2195978 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NW973_RS10845 (NW973_10845) | 2192115..2192780 | - | 666 | WP_001024095.1 | SDR family oxidoreductase | - |
NW973_RS10850 (NW973_10850) | 2192932..2193252 | + | 321 | WP_000003759.1 | Zn(II)-responsive metalloregulatory transcriptional repressor CzrA | - |
NW973_RS10855 (NW973_10855) | 2193254..2194234 | + | 981 | WP_000019744.1 | CDF family zinc efflux transporter CzrB | - |
NW973_RS10860 (NW973_10860) | 2194500..2195591 | + | 1092 | WP_000495669.1 | hypothetical protein | - |
NW973_RS10865 (NW973_10865) | 2195920..2195994 | + | 75 | Protein_2098 | hypothetical protein | - |
- | 2195940..2195978 | + | 39 | - | - | Antitoxin |
NW973_RS10870 (NW973_10870) | 2196033..2196137 | - | 105 | WP_001802298.1 | hypothetical protein | Toxin |
NW973_RS10875 (NW973_10875) | 2196654..2196824 | + | 171 | WP_001792292.1 | transposase | - |
NW973_RS10880 (NW973_10880) | 2196817..2196975 | + | 159 | WP_258410147.1 | integrase | - |
NW973_RS10885 (NW973_10885) | 2197634..2198491 | - | 858 | WP_000370945.1 | HAD family hydrolase | - |
NW973_RS10890 (NW973_10890) | 2198559..2199341 | - | 783 | WP_000908182.1 | ABC transporter ATP-binding protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 35 a.a. Molecular weight: 3906.77 Da Isoelectric Point: 5.5724
>T254671 WP_001802298.1 NZ_CP102961:c2196137-2196033 [Staphylococcus aureus]
MLLLERTSMSDFEMLMVVLTIIGLVLISTQDHKK
MLLLERTSMSDFEMLMVVLTIIGLVLISTQDHKK
Download Length: 105 bp
Antitoxin
Download Length: 39 bp
>AT254671 NZ_CP102961:2195940-2195978 [Staphylococcus aureus]
AACATGTTACCCTAATGAGCCCGTTAAAAAGACGGTGAC
AACATGTTACCCTAATGAGCCCGTTAAAAAGACGGTGAC
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|