Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | sprA1-sprA1AS/- |
| Location | 1917590..1917770 | Replicon | chromosome |
| Accession | NZ_CP102961 | ||
| Organism | Staphylococcus aureus strain 03-RR-88 | ||
Toxin (Protein)
| Gene name | sprA1 | Uniprot ID | - |
| Locus tag | NW973_RS09290 | Protein ID | WP_001801861.1 |
| Coordinates | 1917590..1917685 (+) | Length | 32 a.a. |
Antitoxin (RNA)
| Gene name | sprA1AS | ||
| Locus tag | - | ||
| Coordinates | 1917713..1917770 (-) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NW973_RS09250 (NW973_09250) | 1912628..1913254 | + | 627 | WP_258410736.1 | hypothetical protein | - |
| NW973_RS09255 (NW973_09255) | 1913295..1913636 | + | 342 | WP_000627537.1 | DUF3969 family protein | - |
| NW973_RS09260 (NW973_09260) | 1913737..1914309 | + | 573 | WP_258410737.1 | hypothetical protein | - |
| NW973_RS09265 (NW973_09265) | 1914506..1915134 | - | 629 | Protein_1822 | ImmA/IrrE family metallo-endopeptidase | - |
| NW973_RS09270 (NW973_09270) | 1915248..1915433 | - | 186 | WP_072468070.1 | hypothetical protein | - |
| NW973_RS09275 (NW973_09275) | 1915435..1915611 | - | 177 | WP_103188592.1 | hypothetical protein | - |
| NW973_RS09280 (NW973_09280) | 1915622..1916005 | - | 384 | WP_000070811.1 | hypothetical protein | - |
| NW973_RS09285 (NW973_09285) | 1916692..1917138 | - | 447 | WP_258410738.1 | DUF1433 domain-containing protein | - |
| NW973_RS09290 (NW973_09290) | 1917590..1917685 | + | 96 | WP_001801861.1 | type I toxin-antitoxin system Fst family toxin PepA1 | Toxin |
| - | 1917713..1917770 | - | 58 | - | - | Antitoxin |
| NW973_RS09295 (NW973_09295) | 1917808..1917906 | + | 99 | Protein_1828 | hypothetical protein | - |
| NW973_RS09300 (NW973_09300) | 1917902..1918057 | + | 156 | WP_258410739.1 | hypothetical protein | - |
| NW973_RS09305 (NW973_09305) | 1918614..1919057 | - | 444 | WP_258410740.1 | DUF1433 domain-containing protein | - |
| NW973_RS09310 (NW973_09310) | 1919057..1919500 | - | 444 | WP_258410741.1 | DUF1433 domain-containing protein | - |
| NW973_RS09315 (NW973_09315) | 1919500..1919943 | - | 444 | WP_258410742.1 | DUF1433 domain-containing protein | - |
| NW973_RS09320 (NW973_09320) | 1920579..1921799 | - | 1221 | WP_258410743.1 | restriction endonuclease subunit S | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Prophage | - | lukD / hlgA | 1910863..1939849 | 28986 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 32 a.a. Molecular weight: 3554.32 Da Isoelectric Point: 10.4449
>T254667 WP_001801861.1 NZ_CP102961:1917590-1917685 [Staphylococcus aureus]
VMLIFVHIIAPVISGCAIAFFSYWLSRRNTK
VMLIFVHIIAPVISGCAIAFFSYWLSRRNTK
Download Length: 96 bp
Antitoxin
Download Length: 58 bp
>AT254667 NZ_CP102961:c1917770-1917713 [Staphylococcus aureus]
AACGAAAATAAGTATTTACTTATACACCAATCCCCTCACTATTTGCGGTAGTGAGGGG
AACGAAAATAAGTATTTACTTATACACCAATCCCCTCACTATTTGCGGTAGTGAGGGG
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|