Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | SprA2-SprA2AS/- |
Location | 2422765..2422949 | Replicon | chromosome |
Accession | NZ_CP102959 | ||
Organism | Staphylococcus aureus strain 12-G-51 |
Toxin (Protein)
Gene name | SprA2 | Uniprot ID | Q2FVI9 |
Locus tag | NW979_RS11815 | Protein ID | WP_000482650.1 |
Coordinates | 2422842..2422949 (-) | Length | 36 a.a. |
Antitoxin (RNA)
Gene name | SprA2AS | ||
Locus tag | - | ||
Coordinates | 2422765..2422825 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NW979_RS11800 (NW979_11800) | 2418295..2418462 | - | 168 | WP_001790576.1 | hypothetical protein | - |
NW979_RS11805 (NW979_11805) | 2418693..2420426 | - | 1734 | WP_000486494.1 | ABC transporter ATP-binding protein | - |
NW979_RS11810 (NW979_11810) | 2420451..2422214 | - | 1764 | Protein_2278 | ABC transporter ATP-binding protein | - |
- | 2422765..2422825 | + | 61 | - | - | Antitoxin |
NW979_RS11815 (NW979_11815) | 2422842..2422949 | - | 108 | WP_000482650.1 | type I toxin-antitoxin system Fst family toxin | Toxin |
NW979_RS11820 (NW979_11820) | 2423083..2423469 | - | 387 | WP_000779358.1 | flippase GtxA | - |
NW979_RS11825 (NW979_11825) | 2423737..2424879 | + | 1143 | WP_001176863.1 | glycerate kinase | - |
NW979_RS11830 (NW979_11830) | 2424939..2425598 | + | 660 | WP_000831298.1 | membrane protein | - |
NW979_RS11835 (NW979_11835) | 2425780..2426991 | + | 1212 | WP_001192075.1 | multidrug effflux MFS transporter | - |
NW979_RS11840 (NW979_11840) | 2427114..2427587 | - | 474 | WP_000456489.1 | GyrI-like domain-containing protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 36 a.a. Molecular weight: 4011.78 Da Isoelectric Point: 11.0582
>T254655 WP_000482650.1 NZ_CP102959:c2422949-2422842 [Staphylococcus aureus]
MFNLLINIMTSAISGCLVAFFAHWLRTRNNKKGDK
MFNLLINIMTSAISGCLVAFFAHWLRTRNNKKGDK
Download Length: 108 bp
Antitoxin
Download Length: 61 bp
>AT254655 NZ_CP102959:2422765-2422825 [Staphylococcus aureus]
TACATAATAAATTGAACATCTAAATACACCAAATCCCCTCACTACTGCCATAGTGAGGGGA
TACATAATAAATTGAACATCTAAATACACCAAATCCCCTCACTACTGCCATAGTGAGGGGA
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|