Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | sprA1-sprA1AS/- |
| Location | 1793123..1793305 | Replicon | chromosome |
| Accession | NZ_CP102958 | ||
| Organism | Staphylococcus aureus strain 15-G-54 | ||
Toxin (Protein)
| Gene name | sprA1 | Uniprot ID | - |
| Locus tag | NW969_RS08440 | Protein ID | WP_001801861.1 |
| Coordinates | 1793123..1793218 (+) | Length | 32 a.a. |
Antitoxin (RNA)
| Gene name | sprA1AS | ||
| Locus tag | - | ||
| Coordinates | 1793246..1793305 (-) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NW969_RS08400 (NW969_08400) | 1788793..1789419 | + | 627 | WP_045177256.1 | hypothetical protein | - |
| NW969_RS08405 (NW969_08405) | 1789460..1789801 | + | 342 | WP_045177258.1 | DUF3969 family protein | - |
| NW969_RS08410 (NW969_08410) | 1789902..1790474 | + | 573 | WP_045177260.1 | hypothetical protein | - |
| NW969_RS08415 (NW969_08415) | 1790672..1791300 | - | 629 | Protein_1652 | ImmA/IrrE family metallo-endopeptidase | - |
| NW969_RS08420 (NW969_08420) | 1791415..1791585 | - | 171 | WP_169301139.1 | hypothetical protein | - |
| NW969_RS08425 (NW969_08425) | 1791603..1791779 | - | 177 | WP_000375477.1 | hypothetical protein | - |
| NW969_RS08430 (NW969_08430) | 1791790..1792173 | - | 384 | WP_000070811.1 | hypothetical protein | - |
| NW969_RS08435 (NW969_08435) | 1792777..1792920 | - | 144 | WP_001549059.1 | transposase | - |
| NW969_RS08440 (NW969_08440) | 1793123..1793218 | + | 96 | WP_001801861.1 | type I toxin-antitoxin system Fst family toxin PepA1 | Toxin |
| - | 1793246..1793305 | - | 60 | - | - | Antitoxin |
| NW969_RS08445 (NW969_08445) | 1793341..1793442 | + | 102 | WP_001791893.1 | hypothetical protein | - |
| NW969_RS08450 (NW969_08450) | 1793420..1793596 | - | 177 | Protein_1659 | transposase | - |
| NW969_RS08455 (NW969_08455) | 1793790..1794167 | - | 378 | WP_001037045.1 | DUF1433 domain-containing protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 32 a.a. Molecular weight: 3554.32 Da Isoelectric Point: 10.4449
>T254642 WP_001801861.1 NZ_CP102958:1793123-1793218 [Staphylococcus aureus]
VMLIFVHIIAPVISGCAIAFFSYWLSRRNTK
VMLIFVHIIAPVISGCAIAFFSYWLSRRNTK
Download Length: 96 bp
Antitoxin
Download Length: 60 bp
>AT254642 NZ_CP102958:c1793305-1793246 [Staphylococcus aureus]
ACAACGAAAATAAGTATTTACTTATACACCAATCCCCTCACTATTTGCGGTAGTGAGGGG
ACAACGAAAATAAGTATTTACTTATACACCAATCCCCTCACTATTTGCGGTAGTGAGGGG
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|