Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | SprA2-SprA2AS/- |
Location | 2402668..2402852 | Replicon | chromosome |
Accession | NZ_CP102957 | ||
Organism | Staphylococcus aureus strain 18-H-62 |
Toxin (Protein)
Gene name | SprA2 | Uniprot ID | A0A2P7CQJ7 |
Locus tag | NW959_RS11800 | Protein ID | WP_000482647.1 |
Coordinates | 2402745..2402852 (-) | Length | 36 a.a. |
Antitoxin (RNA)
Gene name | SprA2AS | ||
Locus tag | - | ||
Coordinates | 2402668..2402728 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NW959_RS11785 (NW959_11785) | 2398198..2398365 | - | 168 | WP_001790576.1 | hypothetical protein | - |
NW959_RS11790 (NW959_11790) | 2398596..2400329 | - | 1734 | WP_000486494.1 | ABC transporter ATP-binding protein | - |
NW959_RS11795 (NW959_11795) | 2400354..2402117 | - | 1764 | WP_141062282.1 | ABC transporter ATP-binding protein | - |
- | 2402668..2402728 | + | 61 | - | - | Antitoxin |
NW959_RS11800 (NW959_11800) | 2402745..2402852 | - | 108 | WP_000482647.1 | type I toxin-antitoxin system Fst family toxin | Toxin |
NW959_RS11805 (NW959_11805) | 2402986..2403372 | - | 387 | WP_000779360.1 | flippase GtxA | - |
NW959_RS11810 (NW959_11810) | 2403630..2404772 | + | 1143 | WP_001176863.1 | glycerate kinase | - |
NW959_RS11815 (NW959_11815) | 2404832..2405491 | + | 660 | WP_000831298.1 | membrane protein | - |
NW959_RS11820 (NW959_11820) | 2405673..2406884 | + | 1212 | WP_001192075.1 | multidrug effflux MFS transporter | - |
NW959_RS11825 (NW959_11825) | 2407007..2407480 | - | 474 | WP_000456489.1 | GyrI-like domain-containing protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 36 a.a. Molecular weight: 4012.76 Da Isoelectric Point: 10.4935
>T254639 WP_000482647.1 NZ_CP102957:c2402852-2402745 [Staphylococcus aureus]
MFNLLIDIMTSALSGCLVAFFAHWLRTRNNKKGDK
MFNLLIDIMTSALSGCLVAFFAHWLRTRNNKKGDK
Download Length: 108 bp
Antitoxin
Download Length: 61 bp
>AT254639 NZ_CP102957:2402668-2402728 [Staphylococcus aureus]
TACATAATAAATTGAACATCTAAATACACCAAATCCCCTCACTACTGCCATAGTGAGGGGA
TACATAATAAATTGAACATCTAAATACACCAAATCCCCTCACTACTGCCATAGTGAGGGGA
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|