Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | SprG3-sprA1AS/- |
Location | 2095956..2096153 | Replicon | chromosome |
Accession | NZ_CP102957 | ||
Organism | Staphylococcus aureus strain 18-H-62 |
Toxin (Protein)
Gene name | SprG3 | Uniprot ID | Q2FWA7 |
Locus tag | NW959_RS10210 | Protein ID | WP_001802298.1 |
Coordinates | 2096049..2096153 (-) | Length | 35 a.a. |
Antitoxin (RNA)
Gene name | sprA1AS | ||
Locus tag | - | ||
Coordinates | 2095956..2095994 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NW959_RS10185 (NW959_10185) | 2092074..2092739 | - | 666 | WP_001024095.1 | SDR family oxidoreductase | - |
NW959_RS10190 (NW959_10190) | 2092891..2093211 | + | 321 | WP_000003759.1 | Zn(II)-responsive metalloregulatory transcriptional repressor CzrA | - |
NW959_RS10195 (NW959_10195) | 2093213..2094193 | + | 981 | WP_000019744.1 | CDF family zinc efflux transporter CzrB | - |
NW959_RS10200 (NW959_10200) | 2094459..2095550 | + | 1092 | WP_045177732.1 | lytic regulatory protein | - |
NW959_RS10205 (NW959_10205) | 2095936..2096010 | + | 75 | Protein_1967 | hypothetical protein | - |
- | 2095956..2095994 | + | 39 | - | - | Antitoxin |
NW959_RS10210 (NW959_10210) | 2096049..2096153 | - | 105 | WP_001802298.1 | hypothetical protein | Toxin |
NW959_RS10215 (NW959_10215) | 2096833..2096991 | + | 159 | WP_001792784.1 | hypothetical protein | - |
NW959_RS10220 (NW959_10220) | 2097649..2098506 | - | 858 | WP_258472994.1 | HAD family hydrolase | - |
NW959_RS10225 (NW959_10225) | 2098574..2099356 | - | 783 | WP_216712603.1 | ABC transporter ATP-binding protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 35 a.a. Molecular weight: 3906.77 Da Isoelectric Point: 5.5724
>T254637 WP_001802298.1 NZ_CP102957:c2096153-2096049 [Staphylococcus aureus]
MLLLERTSMSDFEMLMVVLTIIGLVLISTQDHKK
MLLLERTSMSDFEMLMVVLTIIGLVLISTQDHKK
Download Length: 105 bp
Antitoxin
Download Length: 39 bp
>AT254637 NZ_CP102957:2095956-2095994 [Staphylococcus aureus]
AACATGTTACCCTAATGAGCCCGTTAAAAAGACGGTGAC
AACATGTTACCCTAATGAGCCCGTTAAAAAGACGGTGAC
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|