Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | sprA1-sprA1AS/- |
| Location | 1808644..1808824 | Replicon | chromosome |
| Accession | NZ_CP102957 | ||
| Organism | Staphylococcus aureus strain 18-H-62 | ||
Toxin (Protein)
| Gene name | sprA1 | Uniprot ID | - |
| Locus tag | NW959_RS08600 | Protein ID | WP_001801861.1 |
| Coordinates | 1808644..1808739 (+) | Length | 32 a.a. |
Antitoxin (RNA)
| Gene name | sprA1AS | ||
| Locus tag | - | ||
| Coordinates | 1808767..1808824 (-) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NW959_RS08555 (NW959_08555) | 1804406..1805032 | + | 627 | WP_045177256.1 | hypothetical protein | - |
| NW959_RS08560 (NW959_08560) | 1805073..1805414 | + | 342 | WP_045177258.1 | DUF3969 family protein | - |
| NW959_RS08565 (NW959_08565) | 1805515..1806087 | + | 573 | WP_045177260.1 | hypothetical protein | - |
| NW959_RS08570 (NW959_08570) | 1806285..1806913 | - | 629 | Protein_1683 | ImmA/IrrE family metallo-endopeptidase | - |
| NW959_RS08575 (NW959_08575) | 1807028..1807192 | - | 165 | WP_001793442.1 | hypothetical protein | - |
| NW959_RS08580 (NW959_08580) | 1807216..1807392 | - | 177 | WP_000375477.1 | hypothetical protein | - |
| NW959_RS08585 (NW959_08585) | 1807403..1807786 | - | 384 | WP_000070811.1 | hypothetical protein | - |
| NW959_RS08590 (NW959_08590) | 1807888..1808193 | - | 306 | WP_258411726.1 | IS3 family transposase | - |
| NW959_RS08595 (NW959_08595) | 1808235..1808516 | - | 282 | WP_258412590.1 | transposase | - |
| NW959_RS08600 (NW959_08600) | 1808644..1808739 | + | 96 | WP_001801861.1 | type I toxin-antitoxin system Fst family toxin PepA1 | Toxin |
| - | 1808767..1808824 | - | 58 | - | - | Antitoxin |
| NW959_RS08605 (NW959_08605) | 1808862..1808963 | + | 102 | WP_001791232.1 | hypothetical protein | - |
| NW959_RS08610 (NW959_08610) | 1809138..1809581 | - | 444 | WP_086153312.1 | DUF1433 domain-containing protein | - |
| NW959_RS08615 (NW959_08615) | 1809581..1810024 | - | 444 | WP_000439996.1 | DUF1433 domain-containing protein | - |
| NW959_RS08620 (NW959_08620) | 1810067..1811677 | + | 1611 | WP_258411728.1 | lipase | - |
| NW959_RS08625 (NW959_08625) | 1811692..1811991 | + | 300 | WP_000095392.1 | WXG100 family type VII secretion target | - |
| NW959_RS08630 (NW959_08630) | 1812228..1813487 | - | 1260 | WP_258411729.1 | restriction endonuclease subunit S | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Prophage | - | lukD / hlgA / lukS-PV | 1802640..1837919 | 35279 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 32 a.a. Molecular weight: 3554.32 Da Isoelectric Point: 10.4449
>T254633 WP_001801861.1 NZ_CP102957:1808644-1808739 [Staphylococcus aureus]
VMLIFVHIIAPVISGCAIAFFSYWLSRRNTK
VMLIFVHIIAPVISGCAIAFFSYWLSRRNTK
Download Length: 96 bp
Antitoxin
Download Length: 58 bp
>AT254633 NZ_CP102957:c1808824-1808767 [Staphylococcus aureus]
AACGAAAATAAGTATTTACTTATACACCAATCCCCTCACTATTTGCGGTAGTGAGGGG
AACGAAAATAAGTATTTACTTATACACCAATCCCCTCACTATTTGCGGTAGTGAGGGG
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
