Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | SprA2-SprA2AS/- |
Location | 2465092..2465276 | Replicon | chromosome |
Accession | NZ_CP102956 | ||
Organism | Staphylococcus aureus strain 26-G-G |
Toxin (Protein)
Gene name | SprA2 | Uniprot ID | A0A2P7CQJ7 |
Locus tag | NW981_RS12195 | Protein ID | WP_000482647.1 |
Coordinates | 2465169..2465276 (-) | Length | 36 a.a. |
Antitoxin (RNA)
Gene name | SprA2AS | ||
Locus tag | - | ||
Coordinates | 2465092..2465152 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NW981_RS12180 (NW981_12180) | 2460622..2460789 | - | 168 | WP_031860495.1 | hypothetical protein | - |
NW981_RS12185 (NW981_12185) | 2461020..2462753 | - | 1734 | WP_258410232.1 | ABC transporter ATP-binding protein | - |
NW981_RS12190 (NW981_12190) | 2462778..2464541 | - | 1764 | WP_001064814.1 | ABC transporter ATP-binding protein | - |
- | 2465092..2465152 | + | 61 | - | - | Antitoxin |
NW981_RS12195 (NW981_12195) | 2465169..2465276 | - | 108 | WP_000482647.1 | type I toxin-antitoxin system Fst family toxin | Toxin |
NW981_RS12200 (NW981_12200) | 2465410..2465796 | - | 387 | WP_000779358.1 | flippase GtxA | - |
NW981_RS12205 (NW981_12205) | 2466064..2467206 | + | 1143 | WP_001176863.1 | glycerate kinase | - |
NW981_RS12210 (NW981_12210) | 2467266..2467925 | + | 660 | WP_000831298.1 | membrane protein | - |
NW981_RS12215 (NW981_12215) | 2468107..2469318 | + | 1212 | WP_001192075.1 | multidrug effflux MFS transporter | - |
NW981_RS12220 (NW981_12220) | 2469441..2469914 | - | 474 | WP_000456489.1 | GyrI-like domain-containing protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 36 a.a. Molecular weight: 4012.76 Da Isoelectric Point: 10.4935
>T254630 WP_000482647.1 NZ_CP102956:c2465276-2465169 [Staphylococcus aureus]
MFNLLIDIMTSALSGCLVAFFAHWLRTRNNKKGDK
MFNLLIDIMTSALSGCLVAFFAHWLRTRNNKKGDK
Download Length: 108 bp
Antitoxin
Download Length: 61 bp
>AT254630 NZ_CP102956:2465092-2465152 [Staphylococcus aureus]
TACATAATAAATTGAACATCTAAATACACCAAATCCCCTCACTACTGCCATAGTGAGGGGA
TACATAATAAATTGAACATCTAAATACACCAAATCCCCTCACTACTGCCATAGTGAGGGGA
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|