Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | SprA2-SprA2AS/- |
Location | 2427775..2427959 | Replicon | chromosome |
Accession | NZ_CP102955 | ||
Organism | Staphylococcus aureus strain 28-G-I |
Toxin (Protein)
Gene name | SprA2 | Uniprot ID | A0A2P7CQJ7 |
Locus tag | NW961_RS11980 | Protein ID | WP_000482647.1 |
Coordinates | 2427852..2427959 (-) | Length | 36 a.a. |
Antitoxin (RNA)
Gene name | SprA2AS | ||
Locus tag | - | ||
Coordinates | 2427775..2427835 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NW961_RS11965 (NW961_11965) | 2423305..2423472 | - | 168 | WP_031860495.1 | hypothetical protein | - |
NW961_RS11970 (NW961_11970) | 2423703..2425436 | - | 1734 | WP_000486494.1 | ABC transporter ATP-binding protein | - |
NW961_RS11975 (NW961_11975) | 2425461..2427224 | - | 1764 | WP_001064816.1 | ABC transporter ATP-binding protein | - |
- | 2427775..2427835 | + | 61 | - | - | Antitoxin |
NW961_RS11980 (NW961_11980) | 2427852..2427959 | - | 108 | WP_000482647.1 | type I toxin-antitoxin system Fst family toxin | Toxin |
NW961_RS11985 (NW961_11985) | 2428093..2428479 | - | 387 | WP_000779347.1 | flippase GtxA | - |
NW961_RS11990 (NW961_11990) | 2428737..2429879 | + | 1143 | WP_001176863.1 | glycerate kinase | - |
NW961_RS11995 (NW961_11995) | 2429939..2430598 | + | 660 | WP_000831298.1 | membrane protein | - |
NW961_RS12000 (NW961_12000) | 2430780..2431991 | + | 1212 | WP_001192075.1 | multidrug effflux MFS transporter | - |
NW961_RS12005 (NW961_12005) | 2432114..2432587 | - | 474 | WP_000456489.1 | GyrI-like domain-containing protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 36 a.a. Molecular weight: 4012.76 Da Isoelectric Point: 10.4935
>T254623 WP_000482647.1 NZ_CP102955:c2427959-2427852 [Staphylococcus aureus]
MFNLLIDIMTSALSGCLVAFFAHWLRTRNNKKGDK
MFNLLIDIMTSALSGCLVAFFAHWLRTRNNKKGDK
Download Length: 108 bp
Antitoxin
Download Length: 61 bp
>AT254623 NZ_CP102955:2427775-2427835 [Staphylococcus aureus]
TACATAATAAATTGAACATCTAAATACACCAAATCCCCTCACTACTGCCATAGTGAGGGGA
TACATAATAAATTGAACATCTAAATACACCAAATCCCCTCACTACTGCCATAGTGAGGGGA
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|