Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | SprG3-sprA1AS/- |
Location | 2141171..2141368 | Replicon | chromosome |
Accession | NZ_CP102955 | ||
Organism | Staphylococcus aureus strain 28-G-I |
Toxin (Protein)
Gene name | SprG3 | Uniprot ID | Q2FWA7 |
Locus tag | NW961_RS10500 | Protein ID | WP_001802298.1 |
Coordinates | 2141264..2141368 (-) | Length | 35 a.a. |
Antitoxin (RNA)
Gene name | sprA1AS | ||
Locus tag | - | ||
Coordinates | 2141171..2141209 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NW961_RS10475 (NW961_10475) | 2137346..2138011 | - | 666 | WP_001024095.1 | SDR family oxidoreductase | - |
NW961_RS10480 (NW961_10480) | 2138163..2138483 | + | 321 | WP_000003759.1 | Zn(II)-responsive metalloregulatory transcriptional repressor CzrA | - |
NW961_RS10485 (NW961_10485) | 2138485..2139465 | + | 981 | WP_258412249.1 | CDF family zinc efflux transporter CzrB | - |
NW961_RS10490 (NW961_10490) | 2139731..2140822 | + | 1092 | WP_258415634.1 | transcriptional regulator | - |
NW961_RS10495 (NW961_10495) | 2141151..2141225 | + | 75 | Protein_2024 | hypothetical protein | - |
- | 2141171..2141209 | + | 39 | - | - | Antitoxin |
NW961_RS10500 (NW961_10500) | 2141264..2141368 | - | 105 | WP_001802298.1 | hypothetical protein | Toxin |
NW961_RS10505 (NW961_10505) | 2142048..2142206 | + | 159 | WP_001792784.1 | hypothetical protein | - |
NW961_RS10510 (NW961_10510) | 2142864..2143721 | - | 858 | WP_000370929.1 | HAD family hydrolase | - |
NW961_RS10515 (NW961_10515) | 2143789..2144571 | - | 783 | WP_258415635.1 | ABC transporter ATP-binding protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 35 a.a. Molecular weight: 3906.77 Da Isoelectric Point: 5.5724
>T254621 WP_001802298.1 NZ_CP102955:c2141368-2141264 [Staphylococcus aureus]
MLLLERTSMSDFEMLMVVLTIIGLVLISTQDHKK
MLLLERTSMSDFEMLMVVLTIIGLVLISTQDHKK
Download Length: 105 bp
Antitoxin
Download Length: 39 bp
>AT254621 NZ_CP102955:2141171-2141209 [Staphylococcus aureus]
AACATGTTACCCTAATGAGCCCGTTAAAAAGACGGTGAC
AACATGTTACCCTAATGAGCCCGTTAAAAAGACGGTGAC
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|