Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | sprA1-sprA1AS/- |
| Location | 1863726..1863906 | Replicon | chromosome |
| Accession | NZ_CP102955 | ||
| Organism | Staphylococcus aureus strain 28-G-I | ||
Toxin (Protein)
| Gene name | sprA1 | Uniprot ID | - |
| Locus tag | NW961_RS08925 | Protein ID | WP_001801861.1 |
| Coordinates | 1863726..1863821 (+) | Length | 32 a.a. |
Antitoxin (RNA)
| Gene name | sprA1AS | ||
| Locus tag | - | ||
| Coordinates | 1863849..1863906 (-) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NW961_RS08890 (NW961_08890) | 1858767..1859393 | + | 627 | WP_000669017.1 | hypothetical protein | - |
| NW961_RS08895 (NW961_08895) | 1859434..1859775 | + | 342 | WP_000627540.1 | DUF3969 family protein | - |
| NW961_RS08900 (NW961_08900) | 1859876..1860448 | + | 573 | WP_000414215.1 | hypothetical protein | - |
| NW961_RS08905 (NW961_08905) | 1860646..1861274 | - | 629 | Protein_1750 | ImmA/IrrE family metallo-endopeptidase | - |
| NW961_RS08910 (NW961_08910) | 1861574..1861750 | - | 177 | WP_000375476.1 | hypothetical protein | - |
| NW961_RS08915 (NW961_08915) | 1861761..1862144 | - | 384 | WP_000070811.1 | hypothetical protein | - |
| NW961_RS08920 (NW961_08920) | 1862829..1863275 | - | 447 | WP_000747802.1 | DUF1433 domain-containing protein | - |
| NW961_RS08925 (NW961_08925) | 1863726..1863821 | + | 96 | WP_001801861.1 | type I toxin-antitoxin system Fst family toxin PepA1 | Toxin |
| - | 1863849..1863906 | - | 58 | - | - | Antitoxin |
| NW961_RS08930 (NW961_08930) | 1863944..1864045 | + | 102 | WP_001791232.1 | hypothetical protein | - |
| NW961_RS08935 (NW961_08935) | 1864023..1864205 | - | 183 | Protein_1756 | transposase | - |
| NW961_RS08940 (NW961_08940) | 1864393..1864767 | - | 375 | WP_000695818.1 | DUF1433 domain-containing protein | - |
| NW961_RS08945 (NW961_08945) | 1864789..1865067 | - | 279 | WP_001798632.1 | DUF1433 domain-containing protein | - |
| NW961_RS08950 (NW961_08950) | 1865346..1865789 | - | 444 | WP_000742594.1 | DUF1433 domain-containing protein | - |
| NW961_RS08955 (NW961_08955) | 1866437..1867555 | - | 1119 | WP_000072558.1 | restriction endonuclease subunit S | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Prophage | - | lukD / hlgA | 1837693..1885583 | 47890 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 32 a.a. Molecular weight: 3554.32 Da Isoelectric Point: 10.4449
>T254617 WP_001801861.1 NZ_CP102955:1863726-1863821 [Staphylococcus aureus]
VMLIFVHIIAPVISGCAIAFFSYWLSRRNTK
VMLIFVHIIAPVISGCAIAFFSYWLSRRNTK
Download Length: 96 bp
Antitoxin
Download Length: 58 bp
>AT254617 NZ_CP102955:c1863906-1863849 [Staphylococcus aureus]
AACGAAAATAAGTATTTACTTATACACCAATCCCCTCACTATTTGCGGTAGTGAGGGG
AACGAAAATAAGTATTTACTTATACACCAATCCCCTCACTATTTGCGGTAGTGAGGGG
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
