Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | SprA2-SprA2AS/- |
| Location | 2471087..2471271 | Replicon | chromosome |
| Accession | NZ_CP102954 | ||
| Organism | Staphylococcus aureus strain 30-P-10 | ||
Toxin (Protein)
| Gene name | SprA2 | Uniprot ID | Q2FVI9 |
| Locus tag | NW951_RS12245 | Protein ID | WP_000482650.1 |
| Coordinates | 2471164..2471271 (-) | Length | 36 a.a. |
Antitoxin (RNA)
| Gene name | SprA2AS | ||
| Locus tag | - | ||
| Coordinates | 2471087..2471147 (+) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NW951_RS12230 (NW951_12230) | 2466617..2466784 | - | 168 | WP_001790576.1 | hypothetical protein | - |
| NW951_RS12235 (NW951_12235) | 2467015..2468748 | - | 1734 | WP_000486494.1 | ABC transporter ATP-binding protein | - |
| NW951_RS12240 (NW951_12240) | 2468773..2470536 | - | 1764 | WP_001064835.1 | ATP-binding cassette domain-containing protein | - |
| - | 2471087..2471147 | + | 61 | - | - | Antitoxin |
| NW951_RS12245 (NW951_12245) | 2471164..2471271 | - | 108 | WP_000482650.1 | type I toxin-antitoxin system Fst family toxin | Toxin |
| NW951_RS12250 (NW951_12250) | 2471405..2471791 | - | 387 | WP_000779358.1 | flippase GtxA | - |
| NW951_RS12255 (NW951_12255) | 2472059..2473201 | + | 1143 | WP_001176863.1 | glycerate kinase | - |
| NW951_RS12260 (NW951_12260) | 2473261..2473920 | + | 660 | WP_000831298.1 | membrane protein | - |
| NW951_RS12265 (NW951_12265) | 2474102..2475313 | + | 1212 | WP_001192075.1 | multidrug effflux MFS transporter | - |
| NW951_RS12270 (NW951_12270) | 2475436..2475909 | - | 474 | WP_000456489.1 | GyrI-like domain-containing protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 36 a.a. Molecular weight: 4011.78 Da Isoelectric Point: 11.0582
>T254614 WP_000482650.1 NZ_CP102954:c2471271-2471164 [Staphylococcus aureus]
MFNLLINIMTSAISGCLVAFFAHWLRTRNNKKGDK
MFNLLINIMTSAISGCLVAFFAHWLRTRNNKKGDK
Download Length: 108 bp
Antitoxin
Download Length: 61 bp
>AT254614 NZ_CP102954:2471087-2471147 [Staphylococcus aureus]
TACATAATAAATTGAACATCTAAATACACCAAATCCCCTCACTACTGCCATAGTGAGGGGA
TACATAATAAATTGAACATCTAAATACACCAAATCCCCTCACTACTGCCATAGTGAGGGGA
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|