Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | sprA1-sprA1AS/- |
| Location | 1820574..1820754 | Replicon | chromosome |
| Accession | NZ_CP102953 | ||
| Organism | Staphylococcus aureus strain 32-T-13 | ||
Toxin (Protein)
| Gene name | sprA1 | Uniprot ID | - |
| Locus tag | NW977_RS08640 | Protein ID | WP_001801861.1 |
| Coordinates | 1820574..1820669 (+) | Length | 32 a.a. |
Antitoxin (RNA)
| Gene name | sprA1AS | ||
| Locus tag | - | ||
| Coordinates | 1820697..1820754 (-) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NW977_RS08595 (NW977_08595) | 1816336..1816962 | + | 627 | WP_045177256.1 | hypothetical protein | - |
| NW977_RS08600 (NW977_08600) | 1817003..1817344 | + | 342 | WP_045177258.1 | DUF3969 family protein | - |
| NW977_RS08605 (NW977_08605) | 1817445..1818017 | + | 573 | WP_045177260.1 | hypothetical protein | - |
| NW977_RS08610 (NW977_08610) | 1818215..1818843 | - | 629 | Protein_1691 | ImmA/IrrE family metallo-endopeptidase | - |
| NW977_RS08615 (NW977_08615) | 1818958..1819128 | - | 171 | WP_169301139.1 | hypothetical protein | - |
| NW977_RS08620 (NW977_08620) | 1819146..1819322 | - | 177 | WP_000375477.1 | hypothetical protein | - |
| NW977_RS08625 (NW977_08625) | 1819333..1819716 | - | 384 | WP_000070811.1 | hypothetical protein | - |
| NW977_RS08630 (NW977_08630) | 1819818..1820123 | - | 306 | WP_258411726.1 | IS3 family transposase | - |
| NW977_RS08635 (NW977_08635) | 1820165..1820446 | - | 282 | WP_258412590.1 | transposase | - |
| NW977_RS08640 (NW977_08640) | 1820574..1820669 | + | 96 | WP_001801861.1 | type I toxin-antitoxin system Fst family toxin PepA1 | Toxin |
| - | 1820697..1820754 | - | 58 | - | - | Antitoxin |
| NW977_RS08645 (NW977_08645) | 1820792..1820893 | + | 102 | WP_001791232.1 | hypothetical protein | - |
| NW977_RS08650 (NW977_08650) | 1821068..1821511 | - | 444 | WP_086153312.1 | DUF1433 domain-containing protein | - |
| NW977_RS08655 (NW977_08655) | 1821511..1821954 | - | 444 | WP_000439996.1 | DUF1433 domain-containing protein | - |
| NW977_RS08660 (NW977_08660) | 1821997..1823607 | + | 1611 | WP_258411728.1 | lipase | - |
| NW977_RS08665 (NW977_08665) | 1823622..1823921 | + | 300 | WP_000095392.1 | WXG100 family type VII secretion target | - |
| NW977_RS08670 (NW977_08670) | 1824158..1825417 | - | 1260 | WP_258411729.1 | restriction endonuclease subunit S | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 32 a.a. Molecular weight: 3554.32 Da Isoelectric Point: 10.4449
>T254596 WP_001801861.1 NZ_CP102953:1820574-1820669 [Staphylococcus aureus]
VMLIFVHIIAPVISGCAIAFFSYWLSRRNTK
VMLIFVHIIAPVISGCAIAFFSYWLSRRNTK
Download Length: 96 bp
Antitoxin
Download Length: 58 bp
>AT254596 NZ_CP102953:c1820754-1820697 [Staphylococcus aureus]
AACGAAAATAAGTATTTACTTATACACCAATCCCCTCACTATTTGCGGTAGTGAGGGG
AACGAAAATAAGTATTTACTTATACACCAATCCCCTCACTATTTGCGGTAGTGAGGGG
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
