Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | SprG3-sprA1AS/- |
| Location | 2115809..2116006 | Replicon | chromosome |
| Accession | NZ_CP102952 | ||
| Organism | Staphylococcus aureus strain 39-B-49 | ||
Toxin (Protein)
| Gene name | SprG3 | Uniprot ID | Q2FWA7 |
| Locus tag | NW967_RS10240 | Protein ID | WP_001802298.1 |
| Coordinates | 2115902..2116006 (-) | Length | 35 a.a. |
Antitoxin (RNA)
| Gene name | sprA1AS | ||
| Locus tag | - | ||
| Coordinates | 2115809..2115847 (+) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NW967_RS10215 (NW967_10215) | 2111993..2112658 | - | 666 | WP_001024095.1 | SDR family oxidoreductase | - |
| NW967_RS10220 (NW967_10220) | 2112810..2113130 | + | 321 | WP_000003755.1 | Zn(II)-responsive metalloregulatory transcriptional repressor CzrA | - |
| NW967_RS10225 (NW967_10225) | 2113132..2114112 | + | 981 | WP_000019744.1 | CDF family zinc efflux transporter CzrB | - |
| NW967_RS10230 (NW967_10230) | 2114378..2115469 | + | 1092 | WP_258411245.1 | transcriptional regulator | - |
| NW967_RS10235 (NW967_10235) | 2115789..2115863 | + | 75 | Protein_1972 | hypothetical protein | - |
| - | 2115809..2115847 | + | 39 | - | - | Antitoxin |
| NW967_RS10240 (NW967_10240) | 2115902..2116006 | - | 105 | WP_001802298.1 | hypothetical protein | Toxin |
| NW967_RS10245 (NW967_10245) | 2116686..2116844 | + | 159 | WP_001792784.1 | hypothetical protein | - |
| NW967_RS10250 (NW967_10250) | 2117502..2118359 | - | 858 | WP_000370925.1 | Cof-type HAD-IIB family hydrolase | - |
| NW967_RS10255 (NW967_10255) | 2118427..2119209 | - | 783 | WP_258411246.1 | ABC transporter ATP-binding protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 35 a.a. Molecular weight: 3906.77 Da Isoelectric Point: 5.5724
>T254591 WP_001802298.1 NZ_CP102952:c2116006-2115902 [Staphylococcus aureus]
MLLLERTSMSDFEMLMVVLTIIGLVLISTQDHKK
MLLLERTSMSDFEMLMVVLTIIGLVLISTQDHKK
Download Length: 105 bp
Antitoxin
Download Length: 39 bp
>AT254591 NZ_CP102952:2115809-2115847 [Staphylococcus aureus]
AACATGTTACCCTAATGAGCCCGTTAAAAAGACGGTGAC
AACATGTTACCCTAATGAGCCCGTTAAAAAGACGGTGAC
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|