Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | sprA1-sprA1AS/- |
| Location | 1829026..1829208 | Replicon | chromosome |
| Accession | NZ_CP102952 | ||
| Organism | Staphylococcus aureus strain 39-B-49 | ||
Toxin (Protein)
| Gene name | sprA1 | Uniprot ID | - |
| Locus tag | NW967_RS08660 | Protein ID | WP_001801861.1 |
| Coordinates | 1829026..1829121 (+) | Length | 32 a.a. |
Antitoxin (RNA)
| Gene name | sprA1AS | ||
| Locus tag | - | ||
| Coordinates | 1829149..1829208 (-) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NW967_RS08625 (NW967_08625) | 1824696..1825322 | + | 627 | WP_045177256.1 | hypothetical protein | - |
| NW967_RS08630 (NW967_08630) | 1825363..1825704 | + | 342 | WP_045177258.1 | DUF3969 family protein | - |
| NW967_RS08635 (NW967_08635) | 1825805..1826377 | + | 573 | WP_045177260.1 | hypothetical protein | - |
| NW967_RS08640 (NW967_08640) | 1826575..1827203 | - | 629 | Protein_1697 | ImmA/IrrE family metallo-endopeptidase | - |
| NW967_RS08645 (NW967_08645) | 1827506..1827682 | - | 177 | WP_000375477.1 | hypothetical protein | - |
| NW967_RS08650 (NW967_08650) | 1827693..1828076 | - | 384 | WP_000070811.1 | hypothetical protein | - |
| NW967_RS08655 (NW967_08655) | 1828680..1828823 | - | 144 | WP_001549059.1 | transposase | - |
| NW967_RS08660 (NW967_08660) | 1829026..1829121 | + | 96 | WP_001801861.1 | type I toxin-antitoxin system Fst family toxin PepA1 | Toxin |
| - | 1829149..1829208 | - | 60 | - | - | Antitoxin |
| NW967_RS08665 (NW967_08665) | 1829244..1829345 | + | 102 | WP_001791893.1 | hypothetical protein | - |
| NW967_RS08670 (NW967_08670) | 1829323..1829499 | - | 177 | Protein_1703 | transposase | - |
| NW967_RS08675 (NW967_08675) | 1829693..1830070 | - | 378 | WP_001037045.1 | DUF1433 domain-containing protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Prophage | - | lukD / hlgA | 1822136..1856718 | 34582 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 32 a.a. Molecular weight: 3554.32 Da Isoelectric Point: 10.4449
>T254587 WP_001801861.1 NZ_CP102952:1829026-1829121 [Staphylococcus aureus]
VMLIFVHIIAPVISGCAIAFFSYWLSRRNTK
VMLIFVHIIAPVISGCAIAFFSYWLSRRNTK
Download Length: 96 bp
Antitoxin
Download Length: 60 bp
>AT254587 NZ_CP102952:c1829208-1829149 [Staphylococcus aureus]
ACAACGAAAATAAGTATTTACTTATACACCAATCCCCTCACTATTTGCGGTAGTGAGGGG
ACAACGAAAATAAGTATTTACTTATACACCAATCCCCTCACTATTTGCGGTAGTGAGGGG
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|